KEGG   Frankia alni: FRAAL1194Help
Entry
FRAAL1194         CDS       T00384                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fal  Frankia alni
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fal00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1269992..1271335
Genome map
AA seq 447 aa AA seqDB search
MSADFDVVDLIRAKRDGRSLPLAAVDWLVDAYTHGRVADEQMSAYLMAVVWRGMSPPELD
RWTAAMIASGERLDLAGVGRPTVDKHSTGGVGDKVSLVLVPLVAACGVAVPQLSGRGLGH
TGGTLDKMESIPGWRADLPVERMRRQLAEVGAVICAAGAGLAPADRRLYALRDVTGTVES
IPLIASSIMSKKIAEGTSALVLDVKVGSGAFMTSLDDARELARTMVGLGAAAGVRTEAVL
TRMDHPLGRTAGNALEVAEAVDTLRGGGPRDLVEVTVALARVMIQLAGAGRAVGAGGAPA
APDAGGPRAVRDPAEVLAAGDAYPVWREMVAAQGGDPDAVLPRATHIETVPAPASGYLAH
LDARAVGIAAWRLGAGRARKEDAVSATAGVRWRAGIGDRVTAGEPLLEMHTDDPTTLGRA
LAALAGAVTVTPQPPPPTPLVGDHIRA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgacttcgacgtcgtcgatctcatccgcgccaagcgggatggccgctcgcta
ccgctggcggccgtcgactggctggtcgacgcctacacccacggccgggtcgccgacgag
cagatgtcggcctacctgatggcggtggtgtggcggggaatgtccccgcccgagctcgac
cgctggaccgcggcaatgatcgccagcggcgagcggctggacctggccggagtcggccgt
ccgaccgtggacaagcactcgaccggcggggtcggcgacaaggtctcgctggtgctggtg
ccgctggtcgccgcgtgcggcgtcgccgtcccgcagctgtcggggcggggcctcgggcac
accggcgggacgctggacaagatggagtcgatcccgggttggcgcgccgacctgccggtc
gaacggatgcgccgtcagcttgccgaggtgggcgcggtgatctgtgccgccggggccgga
ctggctcccgccgatcgccggctctacgcgctgcgggacgtcaccgggacggtcgagtcg
atcccgctcatcgcctcgtcgatcatgagcaagaagatcgccgagggaacgtccgcgctg
gtcctcgacgtgaaggtcggctcgggggcgttcatgacctcgctggacgacgcccgggag
ctggcgcggaccatggtcgggctcggcgcggccgccggtgtccggaccgaggcggtgctg
acccgcatggaccacccgctggggcggaccgccggcaacgcgctggaggtggccgaggcg
gtcgacacgctgcgtggcggcgggcccagggacctggtcgaggtcaccgtcgccctggct
cgggtgatgatccagctggcgggcgcggggcgggcggtcggcgccggcggggcgccggcg
gctccggacgcgggcgggccgcgggcggttcgtgatccggccgaggtgctggcggccggg
gacgcctacccggtgtggcgggagatggtcgcggcgcagggcggcgatcccgacgcggtc
ctgccacgggcgacccacatcgagaccgtgcccgccccggcgtccggctacctggcgcat
ctcgacgcccgggcggtcggcatcgcggcctggcggctgggcgcggggcgggctcgcaag
gaggacgcggtgtccgcgacggcgggtgtgcgctggcgggcgggcatcggcgaccgggtc
acggcgggggagccgctgctggaaatgcacaccgacgatccgacgaccctcggccgcgcg
ctggccgcgctcgccggcgcggtgacggtcaccccgcagccgccgccgcccaccccgctc
gtcggagaccacatccgcgcctga

DBGET integrated database retrieval system