KEGG   Frankia alni: FRAAL1514Help
Entry
FRAAL1514         CDS       T00384                                 

Definition
P450-like hydroxylase (EC:1.14.14.1)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1615455..1616831
Genome map
AA seq 458 aa AA seqDB search
MVHVQPLSVAAAGPSLVAEAAALRARGPVAEVTLPGGIPAYAVNEHALLRALLLDPRVSK
DPRRHWAQWDEACRRPEWGWVLQWVGVVNMLSTYGVDHARLRRLVAPSFSARRTELLRPA
VVAVTERLLDDLAAGSARAAGSAGSVGSVGSVGSAGSVGSAGSVGSARSVGSAGSAGSVV
DLVGTFAQPLPLAVISGLFGIPDRMRPDFAHVVEQIMNTTVSSEQAAANLGRTRSVLATL
VERKVREPGDDLTSELIGVRDAVTGDRLAHRELLDTLLLLISAGHETTRHLLGNAVHALL
THDRQLRRLRAGEITWDQVVEETLRWAPSIANIPLRFAVTDIDTGAVTIPAGAAIVAGIL
AAGHDPGHHGPGASRFEPGRDAADHLAFGVGVHRCLGAPLARLEAGYALPALFARFPGLA
LATPADDLPQAPSFIVHGWQALPVRLAPPAPLVTASAR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtggttcacgtccagccgctgtccgtcgccgcagcggggccgagcctcgtcgcggaggcc
gccgccctgcgtgcccgcgggccggtcgccgaggtgaccctgcccggcggcatccctgcg
tacgccgtcaacgagcacgcgctgctgcgcgcgttgctgctcgatccgcgcgtcagcaag
gaccctcgccgtcactgggcgcagtgggacgaggcgtgccgccggcccgaatggggctgg
gtcctgcaatgggtgggcgtggtgaacatgctcagcacctacggtgtcgatcatgcccgg
ctgcgccggctggtcgcgccgagtttcagcgcccggcgcaccgagctgctgcgtcccgcc
gtggtggcggtcaccgagcggctgctcgacgacctggccgccgggtcagcccgggccgcc
gggtccgccgggtcggtcgggtcggtcgggtcggtcgggtccgccgggtcggtcgggtcc
gccgggtcggtcgggtccgcccggtcggtcgggtccgccgggtccgccgggtcggtcgtc
gacctggtgggcaccttcgcgcagccgctgccgctggcggtgatcagcgggttgttcggc
atcccggaccggatgcgcccggacttcgcccacgtcgtcgagcagatcatgaacacgacg
gtgagctcggagcaggccgccgcgaacctcggccgtacccggtcggtcctggcgaccctc
gtcgagaggaaggtgcgcgaacccggtgacgatctgaccagcgagctcatcggtgtgcgg
gacgcggtcaccggcgaccggctggcgcaccgggagctgctcgacaccctgctcctgctc
atcagcgccggtcacgagaccacccggcatctgctcggcaacgccgtgcacgcgctgctg
acccacgatcgccagctccgtcggctgcgcgccggggagatcacctgggatcaggtcgtc
gaggagacgctgcggtgggcgcccagcatcgccaacatcccgctgcgcttcgccgtgacg
gacatcgacaccggcgcggtgaccatccccgccggggcggcgatcgtcgcgggcatcctc
gccgccgggcacgaccccggccaccacggccccggggccagccggttcgagcccggccgg
gacgcggccgaccacctcgcgttcggggtcggcgtccaccggtgtctgggcgccccgctg
gcacggctggaggccgggtacgccctgcccgccctgttcgcccgctttcccggcctcgcc
ctcgccacgccggcggatgacctgccgcaggccccctccttcatcgtccacggctggcag
gccctgcccgtccggctcgcgccgcccgccccactggtcacggcatcggcacgatga

DBGET integrated database retrieval system