KEGG   Frankia alni: FRAAL1514Help
Entry
FRAAL1514         CDS       T00384                                 

Definition
(GenBank) putative P450-like hydroxylase (EC:1.14.14.1)
  KO
K20420  
2-hydroxy-5-methyl-1-naphthoate 7-hydroxylase [EC:1.14.99.49]
Organism
fal  Frankia alni
Brite
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.49  2-hydroxy-5-methyl-1-naphthoate 7-hydroxylase
     FRAAL1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1615455..1616831
Genome map
AA seq 458 aa AA seqDB search
MVHVQPLSVAAAGPSLVAEAAALRARGPVAEVTLPGGIPAYAVNEHALLRALLLDPRVSK
DPRRHWAQWDEACRRPEWGWVLQWVGVVNMLSTYGVDHARLRRLVAPSFSARRTELLRPA
VVAVTERLLDDLAAGSARAAGSAGSVGSVGSVGSAGSVGSAGSVGSARSVGSAGSAGSVV
DLVGTFAQPLPLAVISGLFGIPDRMRPDFAHVVEQIMNTTVSSEQAAANLGRTRSVLATL
VERKVREPGDDLTSELIGVRDAVTGDRLAHRELLDTLLLLISAGHETTRHLLGNAVHALL
THDRQLRRLRAGEITWDQVVEETLRWAPSIANIPLRFAVTDIDTGAVTIPAGAAIVAGIL
AAGHDPGHHGPGASRFEPGRDAADHLAFGVGVHRCLGAPLARLEAGYALPALFARFPGLA
LATPADDLPQAPSFIVHGWQALPVRLAPPAPLVTASAR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtggttcacgtccagccgctgtccgtcgccgcagcggggccgagcctcgtcgcggaggcc
gccgccctgcgtgcccgcgggccggtcgccgaggtgaccctgcccggcggcatccctgcg
tacgccgtcaacgagcacgcgctgctgcgcgcgttgctgctcgatccgcgcgtcagcaag
gaccctcgccgtcactgggcgcagtgggacgaggcgtgccgccggcccgaatggggctgg
gtcctgcaatgggtgggcgtggtgaacatgctcagcacctacggtgtcgatcatgcccgg
ctgcgccggctggtcgcgccgagtttcagcgcccggcgcaccgagctgctgcgtcccgcc
gtggtggcggtcaccgagcggctgctcgacgacctggccgccgggtcagcccgggccgcc
gggtccgccgggtcggtcgggtcggtcgggtcggtcgggtccgccgggtcggtcgggtcc
gccgggtcggtcgggtccgcccggtcggtcgggtccgccgggtccgccgggtcggtcgtc
gacctggtgggcaccttcgcgcagccgctgccgctggcggtgatcagcgggttgttcggc
atcccggaccggatgcgcccggacttcgcccacgtcgtcgagcagatcatgaacacgacg
gtgagctcggagcaggccgccgcgaacctcggccgtacccggtcggtcctggcgaccctc
gtcgagaggaaggtgcgcgaacccggtgacgatctgaccagcgagctcatcggtgtgcgg
gacgcggtcaccggcgaccggctggcgcaccgggagctgctcgacaccctgctcctgctc
atcagcgccggtcacgagaccacccggcatctgctcggcaacgccgtgcacgcgctgctg
acccacgatcgccagctccgtcggctgcgcgccggggagatcacctgggatcaggtcgtc
gaggagacgctgcggtgggcgcccagcatcgccaacatcccgctgcgcttcgccgtgacg
gacatcgacaccggcgcggtgaccatccccgccggggcggcgatcgtcgcgggcatcctc
gccgccgggcacgaccccggccaccacggccccggggccagccggttcgagcccggccgg
gacgcggccgaccacctcgcgttcggggtcggcgtccaccggtgtctgggcgccccgctg
gcacggctggaggccgggtacgccctgcccgccctgttcgcccgctttcccggcctcgcc
ctcgccacgccggcggatgacctgccgcaggccccctccttcatcgtccacggctggcag
gccctgcccgtccggctcgcgccgcccgccccactggtcacggcatcggcacgatga

DBGET integrated database retrieval system