KEGG   Frankia alni: FRAAL1628Help
Entry
FRAAL1628         CDS       T00384                                 

Definition
response regulator in two-component regulatory system (EC:3.1.1.61)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1749517..1750251)
Genome map
AA seq 244 aa AA seqDB search
MARVLVVDDDALVAEVVDRYLRNAGFDVDRAADGPSALRTAEARPPDLVVLDLMLPGLDG
LEVFRRLTARRPVPVIMLTARADEADRITGLEVGADDYVTKPFSPRELTLRVRSVLRRAA
EAAAAPEPGVLRAGALVVDPAARTATRHEVPLGLTVREFDLLAFLLRRPGHAFTRVELLE
QVWGWSYGDPSTVTVHIRRLREKIEDDPTAPRLLVTVWGVGYRYDAPPAVAGAEASPGDP
RQAG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgtcctcgtcgtcgacgacgacgccctcgtcgccgaggtcgtcgaccgctac
ctgcgcaacgccggcttcgacgtcgaccgcgccgcggacggcccgagcgccctgcgcacc
gccgaggcccggccgcccgacctcgtcgtcctcgacctgatgctgcccggcctcgacggc
ctcgaagtcttccgccggctgacggcccgccgacccgtcccggtcatcatgctcaccgcg
cgtgccgacgaggcggaccggatcaccggcctggaggtcggcgccgacgactacgtgacc
aaaccgttctccccgcgggagctgaccctgcgggtgcggtcggtgctgcggcgggcggcc
gaagccgccgcggccccggagcccggcgtcctgcgggccggcgccctggtcgtcgacccg
gcggcgcggaccgcgacccgccacgaggtgccactcgggctcaccgtccgcgagttcgac
ctgctggccttcctgctgcgccggcccggccacgccttcacccgggtcgagctgctcgaa
caggtgtggggttggagctacggcgacccgtcgacggtgaccgtgcacatccgccggcta
cgggagaagatcgaggacgatccgaccgccccccgcctgctcgtcaccgtgtggggcgtt
ggctaccgctacgacgccccgccggcggtggccggagcggaggcgtcgccgggcgaccca
cggcaggcgggatga

DBGET integrated database retrieval system