KEGG   Frankia alni: FRAAL1783Help
Entry
FRAAL1783         CDS       T00384                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fal  Frankia alni
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FRAAL1783 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FRAAL1783 (btuE)
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FRAAL1783 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1918100..1918636
Genome map
AA seq 178 aa AA seqDB search
MTVHDFTVDTPDGSSRSLGDYAGQTLLIVNVASKCGLTPQYEGLESIYQELHGRGLEILG
FPCNQFGGQEPGTDEEIQNFCSTNYNVTFPVLSKVEVNGDGAAPLFKYLRAEAPGDFGPE
SGFLYEHVSKTRPEAIGTDEVKWNFTKFLVDGEGNVVRRYEPTVTPEEIRKDLDAVLA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccacgatttcaccgtcgacacccccgacggcagcagccgctcgctgggcgac
tacgccggccagacgcttctgatcgtcaatgttgccagcaagtgcggcctgacgccgcag
tacgaggggctcgagtcgatctaccaggagctgcacggccgcggcctggagatcctcggc
ttcccgtgcaaccagttcggtggccaggagccgggcaccgacgaggagatccagaacttc
tgctcgaccaactacaacgtcaccttcccggtgctgagcaaggtcgaggtgaacggcgac
ggcgccgcgccgctgttcaagtacctgcgcgccgaggcgcccggggacttcgggcccgag
tccggcttcctctacgagcacgtctcgaagacccggcccgaggcgatcggcaccgacgag
gtcaagtggaacttcaccaagttcctcgtcgacggcgagggtaacgtcgtgcgccgctac
gagccgacggtcacccccgaggagatccgcaaggacctcgacgccgtgctggcgtag

DBGET integrated database retrieval system