KEGG   Frankia alni: FRAAL1783Help
Entry
FRAAL1783         CDS       T00384                                 

Gene name
btuE
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fal  Frankia alni
Pathway
fal00480  Glutathione metabolism
fal00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FRAAL1783 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FRAAL1783 (btuE)
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FRAAL1783 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAJ60435
RhizoBase: FRAAL1783
UniProt: Q0RPU4
Position
1918100..1918636
Genome map
AA seq 178 aa AA seqDB search
MTVHDFTVDTPDGSSRSLGDYAGQTLLIVNVASKCGLTPQYEGLESIYQELHGRGLEILG
FPCNQFGGQEPGTDEEIQNFCSTNYNVTFPVLSKVEVNGDGAAPLFKYLRAEAPGDFGPE
SGFLYEHVSKTRPEAIGTDEVKWNFTKFLVDGEGNVVRRYEPTVTPEEIRKDLDAVLA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccacgatttcaccgtcgacacccccgacggcagcagccgctcgctgggcgac
tacgccggccagacgcttctgatcgtcaatgttgccagcaagtgcggcctgacgccgcag
tacgaggggctcgagtcgatctaccaggagctgcacggccgcggcctggagatcctcggc
ttcccgtgcaaccagttcggtggccaggagccgggcaccgacgaggagatccagaacttc
tgctcgaccaactacaacgtcaccttcccggtgctgagcaaggtcgaggtgaacggcgac
ggcgccgcgccgctgttcaagtacctgcgcgccgaggcgcccggggacttcgggcccgag
tccggcttcctctacgagcacgtctcgaagacccggcccgaggcgatcggcaccgacgag
gtcaagtggaacttcaccaagttcctcgtcgacggcgagggtaacgtcgtgcgccgctac
gagccgacggtcacccccgaggagatccgcaaggacctcgacgccgtgctggcgtag

DBGET integrated database retrieval system