KEGG   Frankia alni: FRAAL1846Help
Entry
FRAAL1846         CDS       T00384                                 

Definition
(GenBank) hypothetical conserved protein; putative protein phosphatase
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1990144..1992405
Genome map
AA seq 753 aa AA seqDB search
MSAITAAADAGIALGSQAAARMSQQVRRSASAGLRGARGIVRVLWGGPSSDGRDGPEGSP
ASFLADAGLVLGGTLDPEHVPDLLAGLAVPRFGTGAMVWVRDGDDVRLGATVFVDPKVDK
IMRAIVATRPPRLADEFPPGVVLRNGQTYCLPDFDDLRAKMSFPHELAYQQFRRIQGGPT
VNVPLSVHGRILGAITVGRREGFYTNAEVTLLEDLARRGALALENALRFKEAQESALTLQ
RSLLPAHPPALEGVEIAMEYRPGTAGTEVGGDLYDVIPLSGGRVGVAIGDVMGRGLRAAA
VMGQLRAALRAYALEDWCPAEVLTRLDRVVGLLPGLQLATCIYAVYDRHTGRATIASAGH
PAPLVILPDEDPDYLVLDPGLPLGVGEGGGFSETTVTLPPGSALVMFTDGLVESRRRPLV
DGLENLRRGLIEQRARVAAARAGQAAANGNAADAAGGDASGGTLAGGSGRPGEASTGAWV
DRRAPGPSLGPPPGMADRRSGRDRRTGPDRRVGGERRAGADRRRRARGDSFAARSWFGPD
TVAGTGEGPAEETARSLLERCLIAADLPARTDDDTAMVVLTTQAVNPPLLELALPAVAAS
AGQARMAMRDVMLDYGITSVEDATLLVSEVVTNAVLHARSDLVLRASLEPGRLRISVEDR
EGGHLPRPGAAAANKPDPESGWGLLLVEALSLAWGVETTPGGKRVWFDIEIPDGPGRGIG
GRLPAGSEPPPMSGPPGLGPLPPDPPAQGRGWS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaatcaccgccgcggcggatgccgggatcgccctgggttcgcaggcggccgcc
cggatgtcgcagcaggtgcgccgctcggcgtccgcgggcctgcgcggcgcccgggggatc
gtccgcgtcctgtggggcgggccgagcagcgacggccgggacgggccggagggctcgccg
gcgtcgttcctggccgacgccgggctcgtccttggcggcaccctcgatccggagcacgtc
cccgacctgctcgccgggctcgcggtgccccgcttcggcaccggcgcgatggtctgggtc
cgcgacggcgacgacgtgcggctgggtgccaccgtcttcgtcgacccgaaggtcgacaag
atcatgcgggcgatcgtcgccacccgcccgcccaggctcgccgacgagttcccgcccggc
gtcgtgctgcgcaacgggcagacctactgcctgcccgatttcgacgatctacgagccaag
atgtcgttcccgcacgagctcgcctaccagcagttccgtcgcatccagggcggcccgacg
gtgaacgtgccgctgtcggtgcacgggcggatcctcggcgccatcaccgtcggccggcgc
gagggcttctacaccaacgccgaggtcaccctgctggaggatctggcccgccgcggcgcc
ctggcgctggagaacgccctgcgcttcaaggaggcccaggagtcggcgttgaccctgcag
cgctcgctgctgccggcccatccacccgccctcgagggtgtcgagatcgccatggagtac
cggccggggacggcgggcaccgaggtcggcggcgacctctacgacgtgatcccgctgtcc
ggcggccgggtgggggtcgccatcggcgacgtgatgggccgcgggctgcgggccgccgcg
gtgatgggccagctccgcgcggcgctgcgggcctacgcgctggaggactggtgccccgcg
gaggtcctcacccggctggaccgggtcgtcggcctgctgcccggcctgcagctcgccacc
tgcatctacgcggtctacgaccggcacaccggccgggcgaccatcgccagcgccgggcat
ccggccccgctggtgatcctgcccgacgaggacccggactatctggtgctcgaccccggc
ctgccgctcggcgtcggcgagggcggcggcttcagcgagacgacggtgaccctgccgccg
ggttcggcgctggtgatgttcaccgacgggctggtggagtcgcggcgccggccgctggtc
gacggcctggagaacctgcgccgcgggttgatcgagcagcgtgcccgggtggccgccgcg
cgggccggccaggccgcggcgaacggcaacgccgcggacgccgcagggggggacgcgtcg
ggcggcaccctggccggcggctccggcaggcccggcgaggcgtcgaccggcgcctgggtc
gatcggcgggcgcccggaccctccctcggcccgccgccgggcatggccgaccgtcgcagc
ggccgggaccggcgcaccggcccggatcgccgtgtcgggggcgaacgccgcgccggggcg
gatcggcgccgccgcgcccgcggcgacagcttcgccgcgcggagctggttcggcccggac
acggtcgccggcacgggcgagggtccggccgaggagacggcccgctcgctgctcgaacgg
tgcttgatcgccgccgacctgccggcccgcaccgacgacgacacggccatggtggtgctg
accacccaggcggtgaacccgccgctgctcgagctggcgctgcccgcggtggccgcctcg
gccggccaggctcggatggcgatgcgcgacgtgatgctcgactacggcatcacctcggtc
gaggacgcgaccctgctggtcagcgaggtggtgacgaacgcggttctgcacgcgcgcagc
gacctggtgctgcgggcgtcgctggagccgggccggctgcggatcagcgtcgaggaccgc
gagggcggccacctgccgcgtccgggtgcggcggcggcgaacaagcccgaccccgagtcg
ggctggggcctgctgctggtggaggcgctgtcgctggcctggggcgtcgagacgaccccg
ggcggtaagcgcgtctggttcgacatcgagattcccgacgggccgggacgtggcatcggg
ggccggctgccggccggctccgaaccgccgccgatgtcgggccccccggggctcgggccg
ttgccccccgacccgccggcccagggccggggctggagctga

DBGET integrated database retrieval system