KEGG   Frankia alni: FRAAL1852Help
Entry
FRAAL1852         CDS       T00384                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fal  Frankia alni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FRAAL1852 (malQ)
Enzymes [BR:fal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FRAAL1852 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1999352..2001730
Genome map
AA seq 792 aa AA seqDB search
MAPAPAALGVDAAVAQPADPAEEWTAPAVRELAELAEVAGVATSYRDAEGALVRVAPQTV
RAVLRLLGIDPSDPAAALAEAREAPWRRRLPACAVVSAAAPRPIVVHLPAGAVARAELEL
DTGRRIPLDPPGEPTERRSLDGESWEARPLALPAGLPLGDHVLHVAVGARRLRCALVAVP
DAVPGPSALAEPARAWGWMIQLYALRSASSWGMGDYADLADLADWSGRAGADVLLVNPLH
AAAPTLPVAASPYSPVSRRFAAPLYLRPEATPEYARVDEQTRAAVDELARAARRDGRPDG
LLDRDAVWRAKSTALELLFRAARGAADPDAVDPQAVDPQAVDPQAADTDAAVAGLADFAT
WCALAERHGPDWRAWPAQLAHPGTPAVAAARVELADRIAFHAWLQRRCDDQLAAAQAAAR
GTGMAAGIVHDLAVGVDPGGADAWALQDVLAVDATVGAPPDTFNQQGQDWGLPPWRPQAL
ADTGYAPFRQMVAAVLRRGGGLRVDHILGLFRLWWIPSGAGAANGTYVRYDAEAMLGLVA
LEAARTGAVVVGEDLGTVEPSVATTLARTGVLGSTVLWFEQDDAGRPLPPARYRAATMAS
VTTHDLPTAAGYLEGEHVRLRAGLGLLGRSEQAETAGWRAERDALLDLLQAEGLTGLAEV
TGPAKVTGPAEVTGGGAQFTTAARTELAFALHRLLVRSPCRIVLAAPGDALGDLHQPNLP
GTVDAYPNWRLPVRDADGEEVTVERLRTDPAVARLGALLAEVRGASGTGGAFLTPGRGPS
APLKEDPRPTSR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccggccccggcggccctgggtgtcgatgcggcggtggcgcagcccgcggatccg
gccgaggagtggacggcaccggccgtccgggagctcgccgagcttgccgaggtggccgga
gtcgcgacctcgtaccgcgacgccgagggggcgctcgtgcgggtcgcgccgcagaccgta
cgggcggtcctgcgtctgctggggatcgacccgagcgacccggcggcggccctcgccgag
gcccgggaggcgccctggcggcgccggctgccggcctgcgccgtggtgtcggccgccgcg
ccgcgcccgatcgtcgtgcacctgcccgcgggcgccgtggcacgggccgaactggaactc
gacaccggccggcggatccccctcgacccgccgggcgagcccaccgaacgccgcagcctc
gacggcgagtcgtgggaggcccggccgctcgccctgcccgccgggctgccgctgggcgac
cacgtgctgcacgtcgcggtgggggcgcggcgtctgcgctgtgcgctcgtcgccgtgccg
gacgcggtgcccgggccctcggcgctcgccgagccggcgcgggcctggggctggatgatc
cagctctacgcgctgcggtcggcgtcctcctggggcatgggtgactacgccgacctcgcc
gacctcgccgactggtccggccgggcgggtgcggacgtgctgctcgtcaatcccctgcat
gccgccgccccgaccctgccggtcgccgcgtcgccctactcaccggtcagtcgccgcttc
gccgcgccgctctacctgcgacccgaggcgacgcccgagtacgcgcgggtcgacgagcag
acccgggccgccgtcgacgagctcgcccgtgcggcccgccgggacggtcgcccggacggc
ctgctcgaccgcgacgccgtctggcgggcgaagtccaccgcgctggagctgctgttccgg
gccgcgcgcggcgccgccgaccccgacgccgtcgacccgcaggccgtcgacccgcaggcc
gtcgacccgcaggccgccgacacggatgctgccgttgcggggctggccgacttcgcgacc
tggtgcgcgctggccgagcggcacgggccggactggcgggcgtggcccgcgcagctcgcg
catcccggcacacccgccgtcgcggccgcccgcgtcgagctggccgaccgcatcgccttc
cacgcctggctgcagcggcgctgcgacgaccagctcgccgcggcgcaggccgccgcccgc
ggcaccgggatggccgcggggatcgtgcacgatctcgcggtcggggtcgatccgggcggg
gcggacgcctgggccctgcaggacgtcctcgccgtcgacgccacggtgggggccccaccc
gacacgttcaaccagcagggccaggactggggactgccgccctggcgaccgcaggcgctg
gccgacaccgggtacgcaccgttccggcagatggtggcggcggtgctgcgccgcggcggg
gggctgcgggtggaccacatcctcggcctgttccggctgtggtggatcccgtcgggggcc
ggagcggcgaacggcacctacgtccggtacgacgccgaggcgatgctcgggctggttgcc
ctggaggccgcgcggaccggtgccgtcgtcgtgggcgaggatctgggcaccgtcgaaccg
tccgtggcgaccacgctggcgcgtacgggggtgctcgggtccacggtgctgtggttcgag
caggacgacgccggccgcccgctgccgccggcgcggtaccgggcggcgacgatggccagc
gtcaccacgcacgacctgcccaccgcggcgggctatctcgaaggtgagcacgtgcggctt
cgggccgggctgggcctgctcggacggtccgagcaggcggagaccgccggctggcgcgcc
gagcgggacgcgttgctcgacctgctgcaggccgaggggctgacggggctggccgaggtg
acggggccggccaaggtgacggggccggccgaggtgaccgggggcggggcgcagttcacg
acagcggcccgtaccgaactcgccttcgccctgcaccggctgctggtgcgctcaccgtgc
cgcatcgtgctggccgcccccggcgacgccctcggcgacctgcaccagcccaacctgccc
gggacggtcgacgcctaccccaactggcggctgcccgtgcgcgacgccgacggcgaggag
gtcacggtggaacgcctgcgcaccgaccccgcggtggcgcgactcggcgcgttgctggcc
gaggtccgcggcgcatccggtaccggtggggcctttctcacccccgggcggggaccgtcg
gcacccctgaaagaggaccctcgacccacttcccggtaa

DBGET integrated database retrieval system