KEGG   Frankia alni: FRAAL1978Help
Entry
FRAAL1978         CDS       T00384                                 

Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
fal  Frankia alni
Brite
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     FRAAL1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2146954..2147922
Genome map
AA seq 322 aa AA seqDB search
MRVLVTGATGKVGGAVVRAALEAGHQVRVLVRDPARVPGLPRPVEVVVGDVTDPATLPAA
VAGTEIVFNAMGVPEQWLPDAAEFDRVNVAGSDNVARAAARAGVRRLVHTSTIDVFDAPP
GGRFDETALAAAPKGTPYERSKQRAERAVLAAAGGMQVVIVNPATVYGFPPYGPTSMESR
MFRPALRGLLPAVPPGGFGLVFTEGLARGHLAAAHAGRPGARYILSDAHVGLRELTAAVV
VAGGRGRPPVVTIPAVAASVLAAGGEAVARLTRRPPPLARGQLHYLRWNAIPDATRARTE
LGWEPTPLAEGLRRTLAELDRA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagggtcctggtcaccggcgcgaccggcaaggtcggcggggcggtcgtgcgggccgcg
ctcgaggccggccaccaggtgcgggttctggtccgcgacccggcccgggtgcccggcctg
ccccggccggtcgaggtcgtcgtgggggacgtcaccgatccggcgacgctgccggccgcc
gtggccggaaccgagatcgtgttcaacgccatgggcgttcccgagcagtggctgcccgac
gccgccgagttcgaccgggtcaacgtggccggctcggacaacgtcgcgcgggcggccgcg
cgggccggcgtgcgccggctggtgcacaccagcacgatcgacgtgttcgacgccccaccg
ggcggccgcttcgacgagaccgccctcgccgccgccccgaagggaaccccgtacgagcga
tccaagcagcgcgcggaacgggcggtgctcgccgccgccggtggcatgcaggtggtcatc
gtcaacccggccaccgtctacggcttcccgccctacgggccgacctcgatggaaagccgg
atgttccgcccggcgctgcgcggactgctgcccgccgtcccccccggcggtttcggcctg
gtcttcaccgagggactggcccgcggtcacctcgcggccgcccacgcgggccgtcccggc
gcgcggtacatcctgtccgacgctcatgtcgggctgcgggagctgaccgcggcggtcgtc
gtcgccggggggcggggtcgcccgccggtcgtcaccatcccggccgtggcggcctcggtg
ctcgccgcgggcggcgaggcggtggcccggctgacccgccgcccgccgccgcttgcccgc
ggccagctccactacctgcggtggaacgccatcccggacgccactcgggcccggaccgag
ctcggctgggaaccgaccccgctggccgagggcctgcgccgcaccctcgcggagctcgac
cgcgcctga

DBGET integrated database retrieval system