KEGG   Frankia alni: FRAAL2123Help
Entry
FRAAL2123         CDS       T00384                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
fal  Frankia alni
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    FRAAL2123 (pncA)
Enzymes [BR:fal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     FRAAL2123 (pncA)
    3.5.1.-  
     FRAAL2123 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2319507..2320055)
Genome map
AA seq 182 aa AA seqDB search
MDVQNDFADPAGSLYVAGGEQIVEGVNAEVAAAVAAGSPVFYSQDWHPARTPHFVTDGGV
WPPHCVAGTAGAGFHPDLVVSGEVIRKGVDGADGYSAFSVRDPASGHRSATVLGERLAEL
GVSTLVVVGLAGDHCVRESALDARLQGLTVVLPLARTRFVNLHPGDGERAVAAMRDAGVL
VG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtccagaacgactttgccgacccggcgggcagcctctacgtggccggcggcgag
cagatcgtcgagggggtgaacgccgaggtcgcggccgcggtggccgccggctccccggtg
ttctacagccaggactggcaccccgcgcgcaccccgcacttcgtcaccgacggcggtgtc
tggccgccgcactgcgtggcgggaaccgcgggagccggcttccatcccgacctggtcgtg
tcgggcgaggtgatccgcaagggggtggacggggccgacggctactccgccttctccgtg
cgcgacccggcctcggggcaccggtcggcgaccgtgctcggggagcggctcgccgagctc
ggggtgtcgacgctcgtcgtcgtcggcctggccggcgaccactgcgtccgggagagcgcg
ctggacgcgcggttgcagggtctcacggtggtgctgccgctggctcgaaccagattcgtc
aacctgcatccgggcgacggggagcgggccgtggcggcgatgcgggacgcgggcgtgctg
gtcggctga

DBGET integrated database retrieval system