KEGG   Frankia alni: FRAAL2140Help
Entry
FRAAL2140         CDS       T00384                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fal  Frankia alni
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fal03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2336606..2337364
Genome map
AA seq 252 aa AA seqDB search
MIASLAGTVRALGPLSAVVEVGGVGLLVQCTPATLARLRIGEPASLATTLVVRETELTLY
GFPDADARDVFEILQSAAGVGPKLAQAVLGVHEPDAVRRAVAEEDLAALTKVPGIGRKGA
QRIVLDLRDRLGPPRGAAVPGPRSGGADLGAGGVGAAGPGEAGAVADTVREALIGLGYSA
READDAVSRALAVLAAPSGDPGGPDRPGGNASAVAPSAVAPSAAAPSAGAAPIEGAADAA
TLLRASLAVLRR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcgctggccggcaccgtccgggcgctcgggccgctgtccgccgtcgtcgag
gtgggtggcgtcggcctgctcgtccagtgcaccccggcgacgctggcccggctgcgcatc
ggtgagccggccagcctcgccaccaccctcgtcgtgcgcgagacggagctgaccctctac
ggattccccgacgccgacgcccgcgacgtcttcgagatcctgcagtccgccgccggggtg
gggcccaagctcgcccaggccgtcctcggcgtgcacgagccggacgcggtccgccgggcg
gtcgcggaggaggatctcgccgcgctcaccaaggtgcccgggatcgggcgcaagggcgcc
cagcggatcgtcctcgacctgcgcgaccggctcggcccgccgcgcggcgccgccgtgccc
gggcccaggtcgggcggcgccgatctcggcgccggcggggtcggggcggccggtcccggc
gaggccggcgcggtcgcggacacggtgcgtgaggcgctgatcggcctgggctactcggcg
cgggaggccgacgacgcggtgtcccgcgcgctggccgtgctggccgcgccttcgggcgac
cccggcggtccggaccggccaggcgggaacgcgtcagccgttgccccgtccgcggtggcg
ccgtctgcggcggccccgtccgcgggtgcagcgccgatcgagggcgcggccgacgcggcg
acgctgctgcgggcgagcctggcagtgctgcgccgatga

DBGET integrated database retrieval system