KEGG   Frankia alni: FRAAL2140Help
Entry
FRAAL2140         CDS       T00384                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fal  Frankia alni
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FRAAL2140 (ruvA)
Enzymes [BR:fal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FRAAL2140 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2336606..2337364
Genome map
AA seq 252 aa AA seqDB search
MIASLAGTVRALGPLSAVVEVGGVGLLVQCTPATLARLRIGEPASLATTLVVRETELTLY
GFPDADARDVFEILQSAAGVGPKLAQAVLGVHEPDAVRRAVAEEDLAALTKVPGIGRKGA
QRIVLDLRDRLGPPRGAAVPGPRSGGADLGAGGVGAAGPGEAGAVADTVREALIGLGYSA
READDAVSRALAVLAAPSGDPGGPDRPGGNASAVAPSAVAPSAAAPSAGAAPIEGAADAA
TLLRASLAVLRR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcgctggccggcaccgtccgggcgctcgggccgctgtccgccgtcgtcgag
gtgggtggcgtcggcctgctcgtccagtgcaccccggcgacgctggcccggctgcgcatc
ggtgagccggccagcctcgccaccaccctcgtcgtgcgcgagacggagctgaccctctac
ggattccccgacgccgacgcccgcgacgtcttcgagatcctgcagtccgccgccggggtg
gggcccaagctcgcccaggccgtcctcggcgtgcacgagccggacgcggtccgccgggcg
gtcgcggaggaggatctcgccgcgctcaccaaggtgcccgggatcgggcgcaagggcgcc
cagcggatcgtcctcgacctgcgcgaccggctcggcccgccgcgcggcgccgccgtgccc
gggcccaggtcgggcggcgccgatctcggcgccggcggggtcggggcggccggtcccggc
gaggccggcgcggtcgcggacacggtgcgtgaggcgctgatcggcctgggctactcggcg
cgggaggccgacgacgcggtgtcccgcgcgctggccgtgctggccgcgccttcgggcgac
cccggcggtccggaccggccaggcgggaacgcgtcagccgttgccccgtccgcggtggcg
ccgtctgcggcggccccgtccgcgggtgcagcgccgatcgagggcgcggccgacgcggcg
acgctgctgcgggcgagcctggcagtgctgcgccgatga

DBGET integrated database retrieval system