KEGG   Frankia alni: FRAAL2356Help
Entry
FRAAL2356         CDS       T00384                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
fal  Frankia alni
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL2356 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FRAAL2356 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    FRAAL2356 (aceB)
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FRAAL2356 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2581801..2583531
Genome map
AA seq 576 aa AA seqDB search
MTPSRCAVPPRKPSSPRPAPARGTEMPAPRGGRIEVIGEPGEPRERFREILTPQALEFLI
ALDTVFAARWAGLLAARRERRLLLASGAAVLDFLPETAAIRADESWRVAGAAPGLTDRRV
EIIAPTQRTATVTALNSGARVWLADFADTTAPTWFNVIAGQLNLLDAIEGRLEVTTPTGR
RHRVGPDPATIVVRPRGWHLSEHHLLIDGRPMSASLVDFGLYFFHCARRQLARGSGPYFC
LPKLEGHREARLWNDVFVFAQQRLGLAQGTIRATVPIETVPAAFEMEEILYELREHCAGL
NAAGRWDYVFSLLKTVGARGEAFVLPDRDQLTMTAPFLRAHTALLVRTCHRRGAHAIGAT
AAFVPGRDPEVDARALDQLRRDTQRDADDGFDGSSVAHPGLVAVCEAAFDARLDARLGAV
PRQRDRPRPDDEPVTAADLLDVASAAGTVTEAGLRGSIAVALRYLDAWLRGTGAVAIFDV
MTDAATAELARCQVWQWIHHGTRLADGRPVTRELAERLLAEELTVLCAERGSAPNRLDEA
REVFVETALGETLPEFFTTVAYTDYLTKRPRALVRL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgacaccgtcgcgctgcgcggttccaccgaggaagcccagttcaccgcgaccggcgccg
gcgcggggcactgagatgccggcaccgcgcggcggtcggatcgaggtcatcggcgagccc
ggtgaacctcgggagcgtttccgggagatcctgacgccgcaggcgctggaattcctcatc
gcgctggacaccgtcttcgccgcgcggtgggccggcctgctcgccgcccggcgcgagcgg
cgcctgctgctcgcctccggggcggccgtcctggacttcctgcccgagacggcggccatc
cgcgccgacgagtcatggcgggtcgcgggcgcggcgcccggcctgaccgaccggcgggtg
gagatcatcgcgccgacgcagcggacggcgacggtcaccgcgctgaactccggcgcccgg
gtgtggctggcggacttcgccgacaccacggcgccgacctggttcaacgtgatcgcgggc
cagctcaacctgctcgacgcgatcgagggccggctcgaggtcaccacgccgaccggccgg
cgccaccgggtcgggccggatccggcgacgatcgtcgtccgccctcgtggctggcacctc
agcgagcaccacctgctcatcgacggccgaccgatgtcggcgagcctggtcgacttcggc
ctgtacttcttccactgcgcccgccgccagctcgcccggggcagcggaccgtacttctgc
ctgccgaagctggagggtcatcgcgaggcccgcctgtggaacgacgtgttcgtgttcgcc
cagcagcggctcggcctggcgcagggcacgatccgggcgaccgtgcccatcgagacggtc
cccgcggccttcgagatggaggagatcctctacgagctgcgcgagcactgcgccggcctg
aacgccgccggacgctgggactacgtgttcagcctcctgaagaccgtcggcgcccggggc
gaggcgttcgtgctccccgaccgggatcagctgacgatgacggcgccgttcctgcgggcc
cacaccgcgctgctcgtgcggacctgccaccgccgcggcgcgcacgcgatcggggcgacg
gcggcgttcgtccccggccgggatcccgaggtcgacgcccgcgcgctcgaccagctccgc
cgggacacgcagcgggacgccgacgacgggttcgacggctcctcggtggcccatccgggg
ctggtggcggtgtgcgaggcggcgttcgacgcccgcctcgacgcccgcctcggcgccgtg
ccccgccagcgcgaccggccgcgtccggacgacgagccggtgaccgcggccgacctgctc
gacgtcgcctcggccgccggcacggtcaccgaggcggggctgcgcggcagcatcgcggtg
gcgctgcgctacctcgatgcgtggctgcgcggcaccggcgcggtggcgatcttcgacgtg
atgacggacgccgccaccgccgagctcgcccgctgccaggtctggcagtggatccaccac
ggcacgcggctcgccgacggccgcccggtcacccgggaactcgccgagcgcctgctcgcc
gaggagctgaccgtgctgtgcgccgagcgcggcagcgccccgaaccgcctcgacgaggcc
cgcgaggtgttcgtcgagaccgccctgggcgagacgctgcccgagttcttcaccaccgtc
gcctacaccgactacctgacgaagcgcccccgcgccctcgtccggctctga

DBGET integrated database retrieval system