KEGG   Frankia alni: FRAAL2426Help
Entry
FRAAL2426         CDS       T00384                                 

Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL2426
   00052 Galactose metabolism
    FRAAL2426
Enzymes [BR:fal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     FRAAL2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2647940..2648875)
Genome map
AA seq 311 aa AA seqDB search
MEALAPSGRQVELVHGESSVTITEVGGGLREYRIGGVPVLDGYGADAMASRGRGQLLLPW
PNRIANGRYTFRGTDHQLPVNEVPLGNASHGLTRWSAWQLDRLGPAAARASFILRAQSGY
PFTVSFTAEYRLGDDGLAVTMTATNLGGQPAPVGMGAHPYLMTVGADGATVRADDVELTV
PATTWLETDDRSIPVGAREVAGAPVDFRRPHAVGSLALDTCYTGLARDPDGRARVRLGAP
GGGSVTVWMDETWPYVQVFTGDTLSPQERRRSIAVEPLTCPANAFNSGDGLRVLEPAETV
GGTWGIQATAG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcgttggcgccgtccgggcggcaggtggagctcgtgcacggcgagagcagcgtg
accatcaccgaggtcggcggcgggctgcgcgagtaccggatcggcggcgtgcccgtcctc
gacggctacggcgccgacgcgatggccagccgcgggcgcgggcagttgctgctcccctgg
cccaaccggatcgcgaacggccgctacacgttccgtggcaccgaccaccagctcccggtg
aacgaggtgccgctcggcaacgccagccacgggctgacccgctggtcggcctggcagctc
gaccgcctcggcccggccgccgcccgcgcctcgttcatcctgcgcgcccagagcggctac
cccttcaccgtgagcttcaccgcggagtaccgcctcggtgacgacggcctggccgtcacg
atgaccgccaccaacctgggcggccagccggcgcccgtcgggatgggcgcccatccctac
ctgatgacggtcggggcggacggcgccacggtgcgggccgacgacgtcgaactcaccgtc
ccggcgacgacgtggctggagaccgacgaccgctcgatcccggtcggcgcgcgcgaggtc
gccggcgcacccgtcgacttccgccgcccccacgcggtcggctccctcgccctggacacc
tgctacacgggcctcgcccgcgatccggacgggcgggcgcgcgtgcggctcggcgcaccc
ggcggcggctcggtgacggtgtggatggacgagacctggccctacgtgcaggtcttcacg
ggagacacgctgagcccgcaggagcgtcggcgcagcatcgccgtcgaaccgctgacctgc
ccggcgaacgcgttcaacagcggggacggtctgcgcgtcctcgagcccgccgagaccgtc
ggcggcacctggggcatccaggccaccgccggctga

DBGET integrated database retrieval system