KEGG   Frankia alni: FRAAL2698Help
Entry
FRAAL2698         CDS       T00384                                 

Gene name
pcm
Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase 2 (Protein-beta-aspartate methyltransferase 2) (PIMT 2) (Protein L-isoaspartyl methyltransferase 2) (L-isoaspartyl protein carboxyl methyltransferase 2) (partial match)
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fal  Frankia alni
Brite
Enzymes [BR:fal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FRAAL2698 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_3 Ubie_methyltran MTS Methyltransf_23 Methyltransf_12 DUF938 CMAS Methyltransf_11 RrnaAD GCD14 Methyltr_RsmB-F Fibrillarin Methyltransf_32 PrmA ACP_syn_III_C ADH_zinc_N Methyltransf_18 Methyltransf_2 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: CAJ61344
RhizoBase: FRAAL2698
UniProt: Q0RMA8
Position
complement(2947281..2948531)
Genome map
AA seq 416 aa AA seqDB search
MPATVSDASVSSDPARDLRAKLADRLCQDTVKTPEVETAIRDVPRHLFLPGVPLEQAYAD
DPVYTKHDSGVSISAASQPRIVAMMLEQLHLESGHRVLEVGAGTGYNAALMAAIVGTSGH
ITAVDIDEDLVESARTHLAAAGVTNVDVVLGDGAFGHPDAAPYDRVIATVGAVETPTAWL
DQLAPAGRLVVPLRLAGAASRSIIFERDQDGWISRGSEMCTFMPLRGFGDDARGTVDLTG
TGEVTLQTHRDNSHATNQETLTGVLDTPRYEAWTGVVFGPGESFEWLYLWLACGLANPLM
RMNVDTAAKKRGLVSPMFSTVAMSTSAADGSLAYLTLRPAPPAADGSRQYEVGVLGHGPT
GQQLATDVGQQITLWDQGFRHRHVTFALPDTPPTANTDGGRFVLHRPHRPITVTWE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccactgtcagcgacgccagtgtctcgtccgaccccgcccgcgacctgcgcgcc
aagcttgccgaccgtctgtgccaggacaccgtgaagacgcccgaggtcgagaccgcgatc
cgcgacgtaccccggcacctgttcctgcccggcgtgcccctcgagcaggcgtatgccgac
gatcccgtctacaccaagcacgacagcggcgtgtccatcagcgccgcgtcccagccccgg
atcgtcgcgatgatgctggaacagctccacctcgaatccggccaccgcgtcctggaggtg
ggcgccggcaccggctacaacgccgcgctcatggccgccatcgtcggcacctccggccac
atcaccgcagtcgacatcgacgaagacctcgtcgagagcgcccgaacccacctggccgcg
gctggggtgacgaacgtcgacgtcgtcctcggcgacggcgcgttcggccaccccgacgca
gcaccgtacgaccgggtgatcgccaccgtcggtgccgtcgagacccccaccgcctggctc
gaccagctcgcccccgccggccgactggtcgtgccgctgcgcctggccggcgcggcctcc
cgcagcatcatcttcgagcgcgaccaagacgggtggatcagccgcggcagtgaaatgtgc
acgttcatgcccctccgcggtttcggcgatgacgctcgcggcaccgtcgacctcaccggc
accggcgaagtcaccctgcaaacccaccgggacaacagccacgccaccaaccaggaaacc
ctcaccggcgtcctagacaccccccgctatgaggcgtggactggcgtggtgttcggcccg
ggagagtcgttcgagtggctctacctgtggctggcctgcggactggccaaccccctcatg
cgcatgaacgtcgacaccgcggcgaagaagcgcggcctggtctctccgatgttctcgacc
gttgcgatgtccaccagcgccgcggacggcagcctggcctacctgaccctgcgcccagcc
ccgccggccgcggacggcagccgtcagtacgaggtcggtgtcctcggccacggccccacc
ggacagcagctcgccaccgacgtcggacagcaaatcacgctgtgggatcagggtttccgg
catcgccacgtcaccttcgcactccccgacacaccccccaccgccaacactgacggtggc
cggttcgtcctgcatcgcccccaccgccccatcaccgtcacctgggaatga

DBGET integrated database retrieval system