KEGG   Frankia alni: FRAAL2698Help
Entry
FRAAL2698         CDS       T00384                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase 2 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fal  Frankia alni
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2947281..2948531)
Genome map
AA seq 416 aa AA seqDB search
MPATVSDASVSSDPARDLRAKLADRLCQDTVKTPEVETAIRDVPRHLFLPGVPLEQAYAD
DPVYTKHDSGVSISAASQPRIVAMMLEQLHLESGHRVLEVGAGTGYNAALMAAIVGTSGH
ITAVDIDEDLVESARTHLAAAGVTNVDVVLGDGAFGHPDAAPYDRVIATVGAVETPTAWL
DQLAPAGRLVVPLRLAGAASRSIIFERDQDGWISRGSEMCTFMPLRGFGDDARGTVDLTG
TGEVTLQTHRDNSHATNQETLTGVLDTPRYEAWTGVVFGPGESFEWLYLWLACGLANPLM
RMNVDTAAKKRGLVSPMFSTVAMSTSAADGSLAYLTLRPAPPAADGSRQYEVGVLGHGPT
GQQLATDVGQQITLWDQGFRHRHVTFALPDTPPTANTDGGRFVLHRPHRPITVTWE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccactgtcagcgacgccagtgtctcgtccgaccccgcccgcgacctgcgcgcc
aagcttgccgaccgtctgtgccaggacaccgtgaagacgcccgaggtcgagaccgcgatc
cgcgacgtaccccggcacctgttcctgcccggcgtgcccctcgagcaggcgtatgccgac
gatcccgtctacaccaagcacgacagcggcgtgtccatcagcgccgcgtcccagccccgg
atcgtcgcgatgatgctggaacagctccacctcgaatccggccaccgcgtcctggaggtg
ggcgccggcaccggctacaacgccgcgctcatggccgccatcgtcggcacctccggccac
atcaccgcagtcgacatcgacgaagacctcgtcgagagcgcccgaacccacctggccgcg
gctggggtgacgaacgtcgacgtcgtcctcggcgacggcgcgttcggccaccccgacgca
gcaccgtacgaccgggtgatcgccaccgtcggtgccgtcgagacccccaccgcctggctc
gaccagctcgcccccgccggccgactggtcgtgccgctgcgcctggccggcgcggcctcc
cgcagcatcatcttcgagcgcgaccaagacgggtggatcagccgcggcagtgaaatgtgc
acgttcatgcccctccgcggtttcggcgatgacgctcgcggcaccgtcgacctcaccggc
accggcgaagtcaccctgcaaacccaccgggacaacagccacgccaccaaccaggaaacc
ctcaccggcgtcctagacaccccccgctatgaggcgtggactggcgtggtgttcggcccg
ggagagtcgttcgagtggctctacctgtggctggcctgcggactggccaaccccctcatg
cgcatgaacgtcgacaccgcggcgaagaagcgcggcctggtctctccgatgttctcgacc
gttgcgatgtccaccagcgccgcggacggcagcctggcctacctgaccctgcgcccagcc
ccgccggccgcggacggcagccgtcagtacgaggtcggtgtcctcggccacggccccacc
ggacagcagctcgccaccgacgtcggacagcaaatcacgctgtgggatcagggtttccgg
catcgccacgtcaccttcgcactccccgacacaccccccaccgccaacactgacggtggc
cggttcgtcctgcatcgcccccaccgccccatcaccgtcacctgggaatga

DBGET integrated database retrieval system