KEGG   Frankia alni: FRAAL2747Help
Entry
FRAAL2747         CDS       T00384                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fal  Frankia alni
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FRAAL2747
Enzymes [BR:fal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FRAAL2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2987099..2987665
Genome map
AA seq 188 aa AA seqDB search
MDTTRAVAAVEELLAALEVNEADHTADTPRRVVRAWQETLAGYQADPRRHLARTFTAPDD
PGLVVVAGLHLVTTCAHHLLPIVGRATVAYRPAPGAPVVGLSKLSRVVADYAARLQVQER
LGWQIASAVQDCLAPVGAGCVITAVHGCMTVRGVRQPTAVTTTAVWTGTWTPEHPDVEMV
VAEHRAAG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacgcgggccgtggccgcggtggaggaactgctggccgcgctcgaggtgaac
gaggccgaccacaccgcggacaccccccggcgggtggtccgtgcctggcaggaaacactg
gccggctaccaggccgacccccggcggcatctggcccgcaccttcaccgcgccggacgat
cccgggctggtggtcgtggccggcctgcacctggtcaccacctgcgcccaccacctgctt
cccatcgtcgggcgggccacggtggcctaccgccctgccccgggcgcgccggtggtgggg
ctgtcgaaactgtcccgggtcgtcgcggactacgccgcgcgcctgcaggtgcaggaacgg
ctcggctggcagatcgcctcggcggtccaggactgcctggcaccggtcggggccggctgc
gtcatcaccgccgtccacggctgcatgacggtgcgcggggtccggcagcccacagcggtg
accaccacggcggtgtggaccggcacgtggacgccggaacacccggacgtggagatggtc
gtcgcggagcatcgcgcagcagggtaa

DBGET integrated database retrieval system