KEGG   Frankia alni: FRAAL2747Help
Entry
FRAAL2747         CDS       T00384                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fal  Frankia alni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fal00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2987099..2987665
Genome map
AA seq 188 aa AA seqDB search
MDTTRAVAAVEELLAALEVNEADHTADTPRRVVRAWQETLAGYQADPRRHLARTFTAPDD
PGLVVVAGLHLVTTCAHHLLPIVGRATVAYRPAPGAPVVGLSKLSRVVADYAARLQVQER
LGWQIASAVQDCLAPVGAGCVITAVHGCMTVRGVRQPTAVTTTAVWTGTWTPEHPDVEMV
VAEHRAAG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacgcgggccgtggccgcggtggaggaactgctggccgcgctcgaggtgaac
gaggccgaccacaccgcggacaccccccggcgggtggtccgtgcctggcaggaaacactg
gccggctaccaggccgacccccggcggcatctggcccgcaccttcaccgcgccggacgat
cccgggctggtggtcgtggccggcctgcacctggtcaccacctgcgcccaccacctgctt
cccatcgtcgggcgggccacggtggcctaccgccctgccccgggcgcgccggtggtgggg
ctgtcgaaactgtcccgggtcgtcgcggactacgccgcgcgcctgcaggtgcaggaacgg
ctcggctggcagatcgcctcggcggtccaggactgcctggcaccggtcggggccggctgc
gtcatcaccgccgtccacggctgcatgacggtgcgcggggtccggcagcccacagcggtg
accaccacggcggtgtggaccggcacgtggacgccggaacacccggacgtggagatggtc
gtcgcggagcatcgcgcagcagggtaa

DBGET integrated database retrieval system