KEGG   Frankia alni: FRAAL2805Help
Entry
FRAAL2805         CDS       T00384                                 

Definition
(GenBank) Enoyl-CoA hydratase (Enoyl-CoA hydratase/isomerase family protein)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fal  Frankia alni
Pathway
fal00071  Fatty acid degradation
fal00280  Valine, leucine and isoleucine degradation
fal00281  Geraniol degradation
fal00310  Lysine degradation
fal00360  Phenylalanine metabolism
fal00362  Benzoate degradation
fal00380  Tryptophan metabolism
fal00410  beta-Alanine metabolism
fal00627  Aminobenzoate degradation
fal00640  Propanoate metabolism
fal00650  Butanoate metabolism
fal00903  Limonene and pinene degradation
fal00930  Caprolactam degradation
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01212  Fatty acid metabolism
Module
fal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FRAAL2805
   00650 Butanoate metabolism
    FRAAL2805
  Lipid metabolism
   00071 Fatty acid degradation
    FRAAL2805
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FRAAL2805
   00310 Lysine degradation
    FRAAL2805
   00360 Phenylalanine metabolism
    FRAAL2805
   00380 Tryptophan metabolism
    FRAAL2805
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FRAAL2805
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FRAAL2805
   00281 Geraniol degradation
    FRAAL2805
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FRAAL2805
   00627 Aminobenzoate degradation
    FRAAL2805
   00930 Caprolactam degradation
    FRAAL2805
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FRAAL2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: CAJ61449
RhizoBase: FRAAL2805
UniProt: Q0RM03
Position
complement(3027502..3028770)
Genome map
AA seq 422 aa AA seqDB search
MGGILSVPLFLDSKGGAPMSPHAADAQPLTGSAPGSAHAGHPTGPSSGTASEPEVLVRRE
GPGGRLGRLTLNRPRAINALTPTMVGLLDAALRDWADDPTVAVVVLDGAGERGLCAGGDI
RAIREAVLAGAPERALAFWAGEYRLNARIRRFPKPYIAIMDGIVMGGGIGVSAHGGVRIV
TERSVLSMPEVGIGFIPDVGGTWLLSHAPGELGTHLALTAARIGAADAITAGLADHYLPA
ARLPDLLDALRRAPDPADALAAFDFTAHTPPPGHLTTDRAWIDELYRGDKVTEILAALTA
SPVPAATADAAEIGGKCPTSLVVTLRALRAARSMTSLEAALDQEYRLAGASLATADLVEG
IRAAVVDKDRDPRWSPASLDEVDPAEVDRFFAPVDVELGLAAAQSAAAAQSAAGQSAAAP
AR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgggcggaatcctctcggttccgctgttcctcgactcgaagggtggcgcacccatgtcc
ccgcacgcggctgatgcccagcccctcaccggatcggcacccggatcggcgcacgccggg
caccccaccggtccgtcgtccggcacggcatcggagccggaggtgctggtgcggcgggag
ggcccgggcgggcggctcggacggctcaccctgaaccggccgcgcgcgatcaacgcgctg
acgccgaccatggtcggcctgctcgacgcggcgctgcgggactgggcggacgacccgacg
gtcgccgtcgtcgtcctcgacggcgcgggcgagcgcgggctgtgcgccggcggggacatc
cgggcgatccgcgaggcggtgctcgccggggcacccgagcgggcgctggcgttctgggcg
ggcgagtaccggctcaacgcccgcatccgccggttccccaagccgtacatcgcgatcatg
gacgggatcgtcatgggcggcggcatcggcgtctccgcgcacggcggggtccgcatcgtc
accgagcggtcggtactgagcatgcccgaggtcggcatcggcttcatccccgacgtcggc
ggcacgtggctgctgtcgcacgcccccggcgagctcggcacgcatctggccctcaccgcc
gcccgcatcggcgccgccgacgcgatcaccgccggcctggccgaccactacctgcccgcc
gcccgcctccccgacctgctcgacgcactccgccgcgcgcccgacccggccgacgcgctc
gccgccttcgacttcaccgcccacaccccgccccccgggcatctcaccaccgaccgcgcg
tggatcgacgagctctaccgcggcgacaaggtcaccgagatcctcgcggcgctcacggcg
agccccgtgccggcggcgaccgccgatgcggcggagatcggcggcaagtgcccgacgtcg
ctggtcgtcacgctgcgcgcgctgcgggccgcgcggtccatgacgagcctggaggcggcg
ctcgaccaggagtaccggctggccggggcgagcctcgcgacggcggacctcgtcgagggc
atccgggcggcggtcgtcgacaaggaccgcgacccccgatggtcaccggcgagcctcgac
gaggtcgacccggccgaggtcgaccggttcttcgcccccgtcgacgtcgagctcggcctc
gccgctgcccagtccgctgccgctgcccagtccgccgccggccagtccgccgccgcgccc
gcccgctga

DBGET integrated database retrieval system