KEGG   Frankia alni: FRAAL3041Help
Entry
FRAAL3041         CDS       T00384                                 

Definition
dihydrolipoamide acyltransferases (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fal  Frankia alni
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL3041
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRAAL3041
  Amino acid metabolism
   00310 Lysine degradation
    FRAAL3041
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FRAAL3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3313766..3313996
Genome map
AA seq 76 aa AA seqDB search
MAEELRIPQLGVTMTEGVIGEWLADDGAAVEAGQPLYVLATDKTETEIEAPAAGTLVILG
VPEETYPVGTLVGRIE
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaggaactgcgcattccccagctcggagtgacgatgaccgagggcgtcatcggc
gagtggctcgccgatgacggagccgccgtcgaggcgggccagccgctctacgtcctggcg
accgacaagaccgagaccgagatcgaggcgcccgccgcgggcacgctggtgatcctcggc
gtgccggaggagacctacccggtgggcaccctggtcggccggatcgagtga

DBGET integrated database retrieval system