KEGG   Frankia alni: FRAAL3226Help
Entry
FRAAL3226         CDS       T00384                                 

Definition
(GenBank) putative dihydrolipoamide acyltransferase component E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00020  Citrate cycle (TCA cycle)
fal00620  Pyruvate metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
Module
fal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL3226
   00020 Citrate cycle (TCA cycle)
    FRAAL3226
   00620 Pyruvate metabolism
    FRAAL3226
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FRAAL3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CAJ61870
RhizoBase: FRAAL3226
UniProt: Q0RKT5
Position
complement(3508956..3510380)
Genome map
AA seq 474 aa AA seqDB search
MAAVRAFALPDLGEGLTSAEVVRWFVDVGDVITVDQPVAEVETAKAVVEVPCPYAGVVTS
LAGPAGTGVPVGAALITVAVDDSATAPSAPGSTASSGSGSGPRSGSGSGSGSGSGNILVG
YGVSTEPVRPRRRRVGTIPTPRPAMPSGPSRSSGRPGSAGSAGSVGSGGSAGVAGSAEPS
GSAARTAVAVVSPLVRRLARDHGVDLQVVTGSGPGGLIMRRDVEAAVEGTPAPAPQPAES
DATIVPLDAIGRRAAETFTRSRSEVPDATCWVDADATGLLAARDTLNAGGAEPRIGLLAL
LARVCVAALLRAPELNSSVVTDSDGRATGVRRHGGVHLGFAAQTPRGLAVPVVHHAEDMT
TARLSAELTRLTAAARGGRLTPAELTGGTFTLNNYGVFGVDGSTPIIAHPQVAMLGVGRI
VPRPWAVDGALAVRSVVQLSFTFDHRVCDGATAGAFLRFVADAVEDPTALLRHL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcggtacgcgccttcgcccttcccgacctcggtgaggggctgacctccgccgag
gtggtccgctggttcgtcgacgtcggggacgtcatcaccgtcgaccagcccgtagccgag
gtggagaccgccaaggccgtcgtcgaggtgccctgcccctacgccggcgtcgtcacctcg
ctggccggccccgccggcaccggcgtccccgtcggcgcggcgctgatcaccgtggccgtc
gacgactcggcgacggccccctcggccccgggttccaccgccagctccggatcgggctcc
ggtccgaggtccgggtccgggtcgggatcggggtcggggtcgggaaacatcctcgtcggc
tatggcgtcagcaccgagccggtccggccccgccgccggcgggtcggcaccatcccgacg
ccgcgcccggcgatgccctccggaccgtcgcgatcatccgggcggcccggatcggccgga
tcggccgggtccgtgggatctggcgggtccgcgggggtggccggctcggccgagccctcg
ggatcggccgcgcggaccgcggtcgcggtcgtgtcccccctcgtgcgtcgcctcgcccgc
gaccacggcgtcgacctgcaggtggtgaccggcagcggcccgggcgggttgatcatgcgc
cgcgatgtcgaggccgccgtcgaaggcacgccggcccccgcgccgcagcccgccgagtcc
gacgccaccatcgtccccctcgacgcgatcgggcggcgggccgcggagacgttcacccgc
agccgcagcgaggtgcccgacgccacctgctgggtcgacgccgacgccaccggcctgctc
gccgcccgcgacaccctcaacgccggcggcgccgaaccgcggatcgggctgctcgcgctc
ctcgcccgcgtctgcgtcgcggcgctgctgcgcgcgcccgagctgaactcgtccgtcgtc
accgactccgacggccgcgccaccggcgtgcgtcgccacggcggcgtccatctggggttc
gccgcgcagaccccgcgcgggctggccgtgcccgtggtgcaccacgccgaggacatgacg
acggctcggctgtccgccgagctcacccggctgaccgcggccgcccgcgggggccggctc
accccggccgagctgacgggcggcacgttcacgctgaacaactacggcgtcttcggcgtc
gacgggtccacgccgatcatcgctcacccgcaggtggcgatgctcggggtcggccggatc
gtcccccgtccgtgggcggtggacggcgcgctggccgtacgcagcgtcgtgcagctgtcg
ttcaccttcgaccaccgggtgtgcgacggcgcgaccgccggggcgttcctgcgcttcgtc
gccgacgccgtcgaggaccccaccgcgctgctgcgccacctctga

DBGET integrated database retrieval system