KEGG   Frankia alni: FRAAL3429Help
Entry
FRAAL3429         CDS       T00384                                 

Definition
limonene-1,2-epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
fal  Frankia alni
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FRAAL3429
Enzymes [BR:fal01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     FRAAL3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3713947..3714330)
Genome map
AA seq 127 aa AA seqDB search
MSDKHELLVSQFLDRLVERDYDAAASYVAADARYHVSAWQPAVVGRPAIRAEFDRQAALY
SAFQYELVTVASTDTVVFTERLDSLTMGGRSVVLHWCGVFTFDADGLISVIRDYYDIKEL
EQALAPA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacaagcacgagcttctggtcagccagttcctcgaccggctggtcgaacgggac
tatgacgcggcggcctcctacgtcgccgcggacgcccgttaccacgtcagcgcgtggcag
ccggcggtggtcggacgtccggccatccgcgcggagttcgaccgtcaggccgccctgtac
tcggcgttccagtacgagctggtcacggtggcctcgaccgacaccgtggtcttcaccgaa
cggctcgacagcctcaccatgggcgggcggtccgtcgtcctgcactggtgcggcgtgttc
accttcgacgccgacggcctgatctccgtcatccgcgactactacgacatcaaggagctg
gagcaggccctggcgccagcctga

DBGET integrated database retrieval system