KEGG   Frankia alni: FRAAL3727Help
Entry
FRAAL3727         CDS       T00384                                 

Definition
magnesium-chelatase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
fal  Frankia alni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FRAAL3727
Enzymes [BR:fal01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FRAAL3727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4004989..4007562
Genome map
AA seq 857 aa AA seqDB search
MVSFPLSAVVGMDDLRLALLLNAVSPTLGGVLVRGEKGTAKSTAVRGLAAVLPPVQVVDG
CRFACAPQAPNPDCPDGPHPAAAVGVSRPARLVELPVGASEDRVTGSLDLDRALADGVSV
LRPGLLAAAHRGVLYVDEVNLLGDHLVDLLLDAAALGVAHVERDGVSVRHPASFLLVGTM
NPEEGELRPQLLDRFALTVQVAASRDPALRAQVVRRRLAFEADPDGFAAAWAPAEARLAA
QVADARTRLRAVTLTDAALRAVTAVCAGLDVDGMRADVVLAKTAMALAAWSGHGTVRAAD
IRAGARLALPHRRRRGPFDAPDLDDATLDAVLDAALDGLDATADAELADAATAGTADGDT
AGTAGDGGRSRQDATGDGTGPDNRGPDGFGPDGRGPHPDDDPDGDGPHRDGPHRGGPDGG
GPGSGGSDGDDDRTGPGGSLGAGAGLDGQGPAHGADPATGPDAPPGADDPRLPAAPHRAP
TGAFGASADAEGRGHRAGGGHLTLPPGMRPAFADRPTITAGSARSGAPPDPAAAGAGVAG
APGAAFRPRLLAVAGLGSAAGAAGRRSLARGNRGAVVTTAADAPGMHLPATLLAAAPHQH
ARGRRGPAPILLPADRRGAVRVGREGNLVLFVVDASGSMAAQARMTLVTTAVLALLTDAY
QRRDRIGMITFRGSGAEVVLAPTASVEVGAARLRALPTGGRTPLAAGLTRAGQVLRAERR
RDPARRALLVVVTDGRATAGADPLPVARALVRAAGGAGGPATSRPRGGRGPGGTAGRGGL
ASVVVDCESGFLRLGLAGRLAHALGGITIGLDALPLLTPPPPTTPPPPTTPPPPTTPPPP
TTRPTPPTPRPHARKAA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagcttcccgctgtccgccgtcgtgggcatggacgacctgcgcctggcgctgctg
ctcaacgcggtcagcccgacgctcggcggcgtgctcgtgcgcggggagaagggcaccgcc
aagtccaccgcggtgcgggggctggccgccgtgctgccaccggtgcaggtggtcgacggc
tgccggttcgcctgcgcgccgcaggcgccgaacccggactgccccgacgggccgcatccg
gccgccgcggtgggggtcagccgcccggcgcggctcgtcgagcttcccgtcggcgcctcc
gaggaccgggtgaccggctcgctcgacctcgaccgggccctggccgacggcgtcagcgtg
ctgcgcccggggctgttggccgccgcccaccgcggcgtgctctacgtcgacgaggtcaac
ctgctcggcgatcatctcgtcgatctgctgctcgacgccgccgcgctcggcgtcgcccac
gtcgaacgcgacggggtctcggtgcgtcacccggcgtcgttcctgctggtggggacgatg
aacccggaggagggggagctgcgcccgcagctgctcgaccggttcgcgttgaccgtgcag
gtcgccgccagccgcgatccggcgctgcgcgcgcaggtggtgcgccgccggctggcgttc
gaggccgaccccgacgggttcgccgccgcctgggcgccggccgaggcgcgcctcgccgcc
caggtcgccgacgcccgcacccgcctgcgggcggtcaccctgaccgacgcggcgctgcgc
gcggtgaccgcggtctgcgccgggttggacgtcgacgggatgcgcgcggacgtcgtcctg
gcgaagacggcgatggcgctggccgcctggtccgggcacggcacggtccgcgccgcggac
atccgcgccggcgcgcgcctggccctgccgcatcggcgccgccggggcccgttcgacgcc
cccgacctcgacgacgccaccctcgacgccgtcctcgacgccgcgctcgacggcctcgac
gccaccgccgacgccgaactcgccgacgcggccaccgccggcacggccgacggcgacacc
gccggcacggccggtgacggcggacggtcacgccaggacgcaaccggcgacggaaccggc
cccgacaaccgtggaccggacggcttcggcccggacggccggggcccgcacccggacgac
gaccccgacggcgacggtccgcaccgcgacggtccgcaccgcggcggcccggacggcggc
ggccccggcagcggcggctcggacggcgacgacgaccgcaccggccccggcggctcactc
ggtgccggggccgggctcgacggacagggaccggcgcacggagccgacccggcgacgggc
ccggacgcaccgcccggcgccgacgatccgcgcctgcccgccgcgccgcaccgcgctccc
accggcgcgttcggtgccagcgccgatgccgaggggcgcgggcaccgggcgggcggggga
cacctcaccctcccgccggggatgcgccctgcgttcgcggaccgtccgaccatcaccgcc
ggatccgcccgaagcggcgccccgcccgacccggccgccgccggagcgggggtcgcgggg
gcgcccggggcggcgtttcgaccccggctgctcgccgtcgccggcctgggcagcgccgcc
ggggccgccgggcgccgctccctggcccgcggcaaccgcggggcggtggtcaccaccgcc
gccgacgcccccgggatgcacctgcccgccaccctgctggccgccgccccccaccagcac
gcccgcggccgacgcgggcccgccccgatcctgctgcccgccgaccggcgcggcgcggtg
cgggtcggccgcgagggcaacctggtgctgttcgtcgtcgacgccagcggatcgatggcc
gcccaggcgcggatgaccctggtcaccaccgccgtgctggccctgctcaccgacgcctac
cagcgccgcgaccgcatcggcatgatcacctttcgggggtccggtgccgaggtcgtgctc
gcccccaccgccagcgtcgaggtcggcgccgcccggctgcgcgcgctgccgaccggcggg
cgtaccccgctggccgccgggctcacccgcgccgggcaggtgctgcgcgccgaacgccgc
cgggacccggcccggcgcgccctgctcgtcgtcgtcaccgacgggcgcgccaccgccggc
gccgacccgctgccggtggcccgcgccctggtccgcgccgccggtggcgcggggggaccg
gccaccagtcggccccgcggcgggcgcggcccgggtggcaccgcgggccgcggcgggctg
gccagcgtcgtcgtcgactgcgaaagcggcttcctgcgcctggggctggccggccggctc
gcccacgccctcggcgggatcacgatcggactcgacgccctgccgctgctgaccccaccg
ccgccgacaaccccaccgccgccgacaaccccaccgccgccgacaaccccaccgccgccg
acgacccggccgacgccgccgaccccgcgcccacacgccagaaaggcggcctga

DBGET integrated database retrieval system