KEGG   Frankia alni: FRAAL3781Help
Entry
FRAAL3781         CDS       T00384                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fal  Frankia alni
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fal01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fal01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4054011..4055006)
Genome map
AA seq 331 aa AA seqDB search
MSSESIESTIQRVDAGPPARPDIAPGLKTPLEQILLLLFLVVPLLAVALAVPVAWGHGLG
WHDVVIAAVMYLVSGFGITVGYHRLFTHGSFKASRPLRIGLALAGSLAVEMSVTDWVAAH
RRHHKYSDSAADPHSPWRFGRSAVGVTRGFLHAHVGWLFNRHRTCPKRFCPDLLADRDVA
AVATAFPWCVAASVLIPPIAGGLWSMSWEGALTALFWGSLVRIALLHHVTFSINSICHLI
GERPFTARDQSRNVWWLAVPSLGESWHNLHHADPTSARHGVLPGQLDPSAALIRWFERLG
WAHDVRWPTAERIAARQARPAEPARPAEPAR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctccgaatcgatcgaatcgacaatccagcgtgtcgacgcgggcccgcccgcccgc
cccgacatcgcccccggcctgaagacccccctcgagcagatcctgctcctgctgttcctc
gtcgtcccgctgctcgccgtcgccctggcggtgcccgtggcctggggacacggactgggc
tggcacgacgtcgtcatcgccgcggtgatgtacctggtctccggcttcgggatcaccgtg
ggctaccaccgcctgttcacccacggctcgttcaaggccagccggccgctgcgcatcggc
ctcgccctggccggcagcctcgccgtcgagatgagcgtcaccgactgggtcgccgcccac
cgccgccaccacaagtactccgactccgccgccgatccccattcaccgtggcgtttcggc
cgcagcgccgtcggtgtgaccaggggcttcctgcacgcccatgtcggctggctgttcaac
cgccaccgcacctgcccgaaacgcttctgccccgatctgctcgccgaccgcgacgtcgcc
gccgtcgcgaccgcgttcccctggtgcgtcgccgcctcggtcctgatcccgccgatcgcc
ggcggactgtggagcatgtcgtgggagggcgcgctcaccgccctgttctggggctccctg
gtacgcatcgccctgcttcaccacgtcacgttctcgatcaactcgatctgccacctcatc
ggcgaacggcccttcaccgcccgcgaccagtcgcgcaacgtctggtggctggccgtgccg
tcgctgggggagtcctggcacaacctgcaccacgccgaccccaccagcgcccgccacggc
gtcctgcccggtcagctcgacccgagcgctgcgctcatccgctggttcgaacgcctgggc
tgggcccacgacgtgcgctggccgaccgccgaacgtatcgccgcccgccaggcccgcccc
gccgagcctgctcgcccggccgagcctgctcgctga

DBGET integrated database retrieval system