KEGG   Frankia alni: FRAAL3799Help
Entry
FRAAL3799         CDS       T00384                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fal  Frankia alni
Pathway
fal00071  Fatty acid degradation
fal00280  Valine, leucine and isoleucine degradation
fal00281  Geraniol degradation
fal00310  Lysine degradation
fal00360  Phenylalanine metabolism
fal00362  Benzoate degradation
fal00380  Tryptophan metabolism
fal00410  beta-Alanine metabolism
fal00627  Aminobenzoate degradation
fal00640  Propanoate metabolism
fal00650  Butanoate metabolism
fal00903  Limonene and pinene degradation
fal00930  Caprolactam degradation
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01212  Fatty acid metabolism
Module
fal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FRAAL3799
   00650 Butanoate metabolism
    FRAAL3799
  Lipid metabolism
   00071 Fatty acid degradation
    FRAAL3799
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FRAAL3799
   00310 Lysine degradation
    FRAAL3799
   00360 Phenylalanine metabolism
    FRAAL3799
   00380 Tryptophan metabolism
    FRAAL3799
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FRAAL3799
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FRAAL3799
   00281 Geraniol degradation
    FRAAL3799
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FRAAL3799
   00627 Aminobenzoate degradation
    FRAAL3799
   00930 Caprolactam degradation
    FRAAL3799
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FRAAL3799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAJ62442
RhizoBase: FRAAL3799
UniProt: Q0RJ70
Position
4075323..4076087
Genome map
AA seq 254 aa AA seqDB search
MSDEVLVEHADGVTVITINRPQARNAVNRAVSEGVAAALDEFESRKDLTVAIITGAGGTF
CSGMDLKAFLRGENVAIEGRGLAGITLTPPRKPIIAAVEGFALAGGCEVVLACDLVVAAE
NAAFGIPEVKRSLVAGAGGLLRLPKRIPYQVAMELALTGDQLSAVDAHRYGLVNVLTPVG
EALAGARALAARIAANGPLAVAATKEILASASSWPADEAFDRQAEIMNPVFASADAKEGA
LAFAEKRAPVWRGE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaagttctggtcgaacacgccgacggggtcaccgtcatcacgatcaaccgc
ccgcaggcgcgcaacgccgtgaaccgcgccgtgtccgagggggtcgccgccgccctcgac
gagttcgagtcccgcaaggacctgaccgtggcgatcatcacgggcgcgggcggcacgttc
tgctcggggatggacctcaaggcgttcctgcgcggcgagaacgtcgccattgagggccga
ggcctggccggcatcacgctgacaccgccgcgcaagccgatcatcgccgcggtcgagggc
ttcgccctggccggtgggtgcgaggtcgtgctggcctgcgacctggtcgtcgccgccgag
aacgccgccttcggcatcccggaggtcaagcggagcctcgtcgccggggccggtggcctg
ctgcgcctgcccaagcgcatcccctaccaggtcgccatggagctggcgctgaccggcgac
cagctctccgccgtcgacgcccaccgctacggcctggtcaacgtgctgaccccggtcggt
gaggcgctggccggcgcccgggcgctcgccgcccggatcgcggcgaacggcccgctggcc
gtggccgcgaccaaggagatcctcgcgtcggcgtcctcctggccggcggacgaggcgttc
gaccgccaggcggagatcatgaatccggtgttcgcctccgcggacgccaaggagggcgcg
ttggcgttcgccgagaagcgggcgccggtctggcgcggcgagtga

DBGET integrated database retrieval system