KEGG   Frankia alni: FRAAL3962Help
Entry
FRAAL3962         CDS       T00384                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fal  Frankia alni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FRAAL3962 (rbsK)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FRAAL3962 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4262346..4263260
Genome map
AA seq 304 aa AA seqDB search
MAGRVFVFGSLNMDIVASVPLLPVLGETVASTTMTFLPGGKGGNQAVAAARAGAPTSMIG
RVGEDAFGRTLRRFLADNGVDVARVESVGDRPTGTALVTVDTAGDNTVVISSGANDTLAP
AAVDVSGLTPEDVVVAQFESPVSAVSTFLAAAGSRGATTVLNAAPARDLPPDLESSVDIL
VVNENELATLSGRQVDSESPTSAILSAITAVPGSRAVATIATVGSRGVVGRLGDLDYALP
ARPVRAVDTAGAGDCFVGVLAARIAAGDDLGVGIRHANTAASLCVQRPGGAPAMPTWDEI
ERSA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggtagggtcttcgtcttcggcagcctcaatatggacattgtggcctccgtgccg
ctgctgcccgttctcggcgagacggttgccagcaccaccatgacctttcttcctggcggc
aagggcgggaaccaggctgttgccgcagcccgcgcgggagctcccacgtcgatgatcggt
cgagtcggcgaggacgccttcggtcggactctgcgcaggtttctggcggacaacggtgtc
gatgtcgcccgggtggagtccgtcggcgaccgacccaccggcaccgctctggtcacggtc
gatacggccggcgacaacacggtggtcatctcctccggggcgaacgacacccttgctccc
gccgcggtcgacgtttccggactaacgcccgaggatgtggtcgtggcccagttcgagtcg
cccgtcagcgcggtctcgaccttcctggcggcggccggctcccgcggtgcgaccacagtg
ctgaatgcggcgccagccagggacctgccgcccgatctcgagtcgtccgtggacattctc
gtcgtgaacgagaacgaactcgcgacgctttcgggtcggcaggtcgactcggagtcgccg
acctccgccatcctgtcggcgatcactgcggtgccggggtcccgcgcggtcgccacgatc
gccacggtgggcagcaggggggtcgtgggcaggctcggcgacctggactacgccctgccg
gcgcgcccggtgcgggcggtcgacaccgccggagccggcgactgtttcgtgggcgtgctc
gccgcgcggatcgccgccggcgatgatctcggtgtcgggatccgccacgcgaacaccgcg
gcctcgctgtgcgtgcaacggcccggcggggcgcccgcgatgccgacctgggacgagatc
gagcgctccgcatag

DBGET integrated database retrieval system