KEGG   Frankia alni: FRAAL4014Help
Entry
FRAAL4014         CDS       T00384                                 

Gene name
melA
Definition
alpha galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fal  Frankia alni
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FRAAL4014 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    FRAAL4014 (melA)
   00600 Sphingolipid metabolism
    FRAAL4014 (melA)
Enzymes [BR:fal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FRAAL4014 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4316019..4317575
Genome map
AA seq 518 aa AA seqDB search
MTLAGPRSHTADEPHSANAPHAADAPHAANEPHAEGKPHAANEPHAEGDLARGRGRARVA
VALGALVVLLLTCLRGDGGGVPLVADSTANRQVSAGLARTPPMGWNSWNAFGGTVRDGDV
RAAADALVRSGMRAAGYRYVIVDDGWMAPTRGGDGRLVADPERFPAGIAALAAYVHARGL
RFGLYASPGRTTCQGLPGSLGHEAADAATFAAWGVDYLKYDACGYPDLRPAGTDARRWLI
AGFGRMRAALDATGRPVVFSINPSAGGDPAAARAWTWAPRVAHLWRVTNDQAPCWASTEP
MDGYPGVCTVDNLDAARAWAAAGGPGHWNDLDMLTIGLTPTTANPGVRELAGLATATPAA
ALDDTEARGELSVWSMLASPLLAGNDLTRMTATTAAILTNAAVLAIDQDPLGAAPVPVPR
RDGLALWTRPLADGDTAVLAVNRSDSPRAATLTRAELALPATAAGYRATDLWTGTITTLA
GGPLPLTLAPHAAALLRLTSAKPAPARSAAAGPTPAGP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcgccggtccacggtcgcacaccgcggacgagccccacagcgcgaacgcgccc
cacgccgcagacgcgccccacgccgcgaacgagccccacgccgagggcaagccccacgcc
gcgaacgagccccacgccgagggcgacctggcgcggggacgtggcagggcgcgcgtcgcc
gtggcgctcggtgcgctggtcgtcctgctgctgacgtgcctgcgcggcgatggcggcggc
gtcccgctcgtcgccgactcgacggcgaaccgacaggtctcggcggggctcgcccgcacc
ccgccgatgggctggaactcgtggaacgccttcggcgggaccgtgcgcgacggcgacgtc
cgagccgccgccgacgccctggtgcgctcggggatgcgtgccgccggctaccgctacgtg
atcgtcgacgacgggtggatggcgccgacccgcggcggcgacgggcgcctcgtggccgat
ccggagcggtttcccgccggcatcgccgccctcgccgcctacgtgcacgcccggggcctg
cggttcggcctctacgcctcccccggccgcaccacctgccagggactgcccggcagcctc
ggccacgaggccgccgacgccgccaccttcgccgcgtggggggtcgactacctcaagtac
gacgcctgcggctacccggacctgcgcccggccggtaccgacgcccgcaggtggctgatc
gccgggttcggtcggatgcgcgccgcgctcgacgccaccggccggcccgtcgtgttcagc
atcaacccgtcggcgggcggcgatcccgcggccgcgcgggcgtggacctgggcgccgcgg
gtcgcccacctgtggcgggtcaccaatgatcaggctccctgctgggcgtccaccgaaccg
atggacggctacccgggcgtctgcacggtggacaacctcgacgccgcccgcgcctgggcg
gccgccggcggcccaggccactggaacgacctggacatgctgacgatcggcctgaccccg
accacggccaaccccggggtgcgcgaactggccggcctcgccaccgcaaccccggcggcc
gccctcgacgacaccgaggcccgcggcgagctgagcgtctggtcgatgctcgcctccccg
ctgctcgcaggcaacgatctgaccaggatgaccgcgacgacggccgcgatcctcacgaac
gccgccgtgctcgccatcgaccaggacccgctcggcgccgcgccggtgccggtgccccgc
cgcgacggtctcgcgctgtggacccggccgctggccgacggcgacacggccgtgctggcc
gtcaaccggagcgactccccccgcgcggcgactctcacccgggccgagctggccctgccg
gcaaccgccgccggctaccgcgccaccgacctgtggacgggcacgatcaccacccttgcc
ggcggcccgctgcccctgaccctcgcgccgcacgccgccgccctgctccgcctcacctcc
gccaagcccgcccccgccagatccgccgcggcgggacccaccccggccggaccctga

DBGET integrated database retrieval system