KEGG   Frankia alni: FRAAL4186Help
Entry
FRAAL4186         CDS       T00384                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fal  Frankia alni
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fal03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4546467..4548737
Genome map
AA seq 756 aa AA seqDB search
MTTARSSADAARQAVVEGVLERITFVSEETGYTIARLATERSGPDLLTVVGPLLGAQIGE
SLRLTGQWGSHPRYGRQFQVHSYTTVLPATIQGIRRYLGSGLIKGIGPAMAERMVAHFDT
DILRIIEEEPARLIEVRGLGPKRTKKIADAWEEQKAIKEVMVFLQGVGVSTSLAVKIYKK
YGDQSIGVVRTQPYRLATDVWGIGFRTADTIAQAVGIPHDSPERIKAGLQYTLSQAADDG
HCFLPAPNLITDAAKILEVERELIGPCLDQLAADEGVIREGVPAGDATVPAVYLVPFHRA
ETSLAGGLLTLLTCAEERLASFADVDWDRALGWLRGRTGQDLADEQAEAVRLALTRKVAV
LTGGPGCGKSFTVRSVVELARARKARVVLVAPTGRAAKRLAELTGHEASTVHRLLELQPG
GDPRYDRDNPLDADLVVVDESSMMDVILANKLVKAVPPGAHLLLVGDVDQLPSVGAGEIL
RDLLAADAIPRVRLTRIFRQAQQSGIVVNAHRINAGTPPQLTGFSDFFWFTCEPADDSGL
HPAEETAKMVVDIVARRIPQRFGLDPRRDVQVLAPMHRGPAGAGNLNLLLQEALTPAREG
APERRYGGRVFRVGDKVTQLRNNYDKGKAGVFNGTVGVVTAINTEDQTLTMLSDEDESLV
YDFSELDELAHAYAVSIHRSQGSEYPAVVLPLTTSSWMMLQRNLLYTGVTRAKKLVVLVG
SRRALAAAVRTPGAGRRHTALTHRIAPSVEPAAPRT
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactgcccgttcttctgctgacgccgcgcgtcaggcggtggtggagggggtgctg
gagcggatcaccttcgtcagcgaggagaccggctacaccatcgcccggctggccaccgag
cggtccggtccggacctgctgacggtggtcggcccactgctgggtgcgcagatcggggag
agtctgcggctgaccgggcagtggggtagccatccccggtacggcaggcagttccaggtg
cactcgtacaccacggtgctgcccgcgacgatccagggcattcgccgctacctgggctcg
gggctgatcaaggggatcgggccggcgatggccgagcggatggtcgcgcatttcgacacc
gacatcctgcggatcatcgaggaggagccggcccggctgatcgaggtccgcgggctggga
cccaaacgcaccaagaagatcgccgatgcctgggaggaacagaaggcgatcaaggaggtg
atggtgttcctgcagggagtgggggtgtccacctccctcgcggtgaagatctacaagaag
tacggcgaccagtccatcggcgtcgtgcgcacacagccctaccggctcgccaccgacgtg
tggggaatcgggttccggaccgccgacaccatcgcccaggcggtcggtatcccccacgac
agccccgaacggatcaaggccggcctgcagtacaccctctcgcaggccgccgacgacggg
cactgcttcctgcccgccccgaacctgatcaccgatgcggcgaagatcctcgaggtcgag
cgggaactgatcggcccgtgcctggaccagctcgccgccgacgagggtgtgatccgcgaa
ggcgtccccgccggggacgccaccgtcccggcggtctacctggtgccgttccaccgcgcg
gagacgtccctcgccggcgggctgctgacgctgctcacctgcgccgaggagcggttggcg
tcgttcgcggacgtggactgggacagggcgctgggctggctgcggggccggaccggtcag
gacctcgccgacgagcaggcggaggcggtcaggctcgcgctcacccgcaaggtggcggtg
ctcaccggcgggccgggctgcggcaagagcttcaccgtccggtcggtggtggaactcgcc
cgggcccgcaaggcccgcgtggtgctggtcgcgccgaccgggcgggccgccaaacggctg
gcggaactcaccggccacgaggcctccaccgtccaccggctgctggagctgcaacccggc
ggcgaccccagatacgaccgggacaacccgctcgacgccgatctggtggtcgtcgacgaa
tcctcgatgatggacgtcatcctggccaacaagctggtcaaggcggtcccgccgggggcg
catctgctgctggtcggtgacgtggaccagcttccctccgtcggcgccggggagatcctg
cgcgatctgctcgccgccgacgcgatccccagggtccggctgaccaggatcttccggcag
gcccagcagtccggcatcgtcgtcaacgcccaccggatcaacgccggaacacccccgcag
ctgaccggtttcagcgacttcttctggttcacctgcgagccggccgacgactccggcctg
catccggcggaggagaccgcgaagatggtggtggacatcgtcgcccgccggatcccgcaa
cgtttcgggctcgatccccgccgcgacgtgcaggtgctggcgccgatgcaccgcgggccc
gccggagccggaaacctcaacctgctcctgcaggaggccctcaccccggcccgcgaaggc
gcacccgagcgccgctacggcgggcgggtgttccgcgtcggcgacaaggtcacccagctg
cgcaacaactacgacaagggtaaggccggggtgttcaacggcaccgtcggcgtcgtcacc
gccatcaacaccgaggaccagacgctgaccatgctctccgacgaggacgagagcctcgtc
tacgacttctccgaactcgacgaactcgcccacgcctacgccgtcagcatccaccgctcc
cagggcagcgaataccccgccgtcgtccttcccctcaccacctcctcctggatgatgctg
caacgcaacctgctctacaccggcgtcacccgcgccaagaagctcgtcgtcctggtgggc
tcccgcagggcgctcgcggccgcggtccgcaccccgggcgccgggcgtcgccacaccgcc
ctcacccaccgcatcgccccgtcggtcgagcctgcggcgccgcggacctga

DBGET integrated database retrieval system