KEGG   Frankia alni: FRAAL4219Help
Entry
FRAAL4219         CDS       T00384                                 

Definition
(GenBank) conserved hypothetical protein (Putative membrane protein)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(4584205..4585122)
Genome map
AA seq 305 aa AA seqDB search
MTQTIPPGWYADPSGQHGSRWWDGSQWTEHTQPPPGQGGGYGQGGEYGPGGQIGQYGQDQ
AAAVPGQAWGAPLGVQPGAVYTKHSAEQVQRQVQEQAGVQPAGPGGGTLFSEPVLVVNQK
SKIIEVTNEYAVFDQGGKQIGSVVEVGQSALKKAARVLTSWDQFFSHRLEVRDAAGTVQL
LLHRPAKVFKSKVIVSLPDGSELGVIAQQNVFGKIRFDLQAGGTTIGAIKAENWRAWNFS
IVDQNDVEVARVTKTWEGLARAMFTTADNYVVQLHRPLPQPLHSMVVAAALTIDTALKQD
SRGLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaccatcccgcccggctggtacgccgatccgagcgggcagcacggatcccga
tggtgggacggaagccagtggaccgagcacacccagccgccccccggccagggcgggggg
tacggccagggcggggagtacggccccggcgggcagatcggccagtacgggcaggaccag
gccgcggccgttccggggcaggcgtggggcgcgccactgggagtgcagccgggcgcggtg
tacacgaagcacagcgccgagcaggtgcagcggcaggtccaggagcaggccggggtgcaa
ccggcgggcccgggtggggggacgctgttcagcgagcccgtgctcgtggtcaaccagaag
tccaagatcattgaagtgaccaacgagtacgccgtcttcgaccagggcggcaaacagatc
ggctcggtcgtcgaggtcggccagagcgcgctgaagaaggctgcccgggtgctcacctcg
tgggaccagttcttctcccaccgcctggaggtccgcgacgccgccggtaccgtccagctg
ctcctgcaccgcccggcgaaggtgttcaagtccaaggtgatcgtctcgttgccggacggg
tccgagctcggcgtcatcgcgcagcagaacgtcttcggcaagatccggttcgacctgcag
gcgggcggcacgacgatcggcgcgatcaaggccgagaactggcgggcgtggaacttctcg
atcgtcgaccagaacgacgtcgaggtcgcccgggtcaccaagacctgggagggcctcgcg
cgggcgatgttcaccacggccgacaactacgtcgtccagcttcaccggccgctgccgcag
ccgctgcacagcatggtcgtcgccgccgccctcaccatcgacacggcgctcaagcaggat
tcccgcggcctcggctga

DBGET integrated database retrieval system