KEGG   Frankia alni: FRAAL4376Help
Entry
FRAAL4376         CDS       T00384                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL4376
   01230 Biosynthesis of amino acids
    FRAAL4376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL4376
   00030 Pentose phosphate pathway
    FRAAL4376
   00051 Fructose and mannose metabolism
    FRAAL4376
   00052 Galactose metabolism
    FRAAL4376
  Energy metabolism
   00680 Methane metabolism
    FRAAL4376
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FRAAL4376
Protein phosphatases and associated proteins [BR:fal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FRAAL4376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4751482..4752732)
Genome map
AA seq 416 aa AA seqDB search
MGERPTTQHYIDEADKVLYDDTTSMIAAREVDLAELPGFEPAGPRRKIYFDPSKTRVGIV
TCGGLCPGLNNVIRGLVLELTSHYRVRRIFGFRNGYQGFIARYGHDVVDLTPESVANIDD
DGGTILGSSRGQQDPGEIVDCLSRMNINILFVIGGDGTLRGAKEISRVATERGEKIAVVG
IPKTIDNDIPYIDQSFGFQTAFGKAAESIRVAHAEATSAPGGMGVVRLMGRHSGFIACYA
TLAKSNADVVLIPELPFKLEGEGGLLNYLRRRVVERGHAVVVVAEGAGQELITDQPEGSD
ASGNRKLHDVGPVLSRRITEHFANEGVELNLKYIDPSYLIRSVPANPYDNVYTIRLAHAA
VHAAMSGRTEMVVGRWRRRFIHIPIALAVSQRNQVDPAGDLWMSVLEATGQPPHFE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgggggaacggccgacgacacagcattacatcgacgaggcggacaaggtcctctacgac
gacaccacgtcgatgatcgccgcccgggaggtcgacctcgccgagctaccggggttcgag
ccggccggcccgcgccggaagatctacttcgacccgtccaagacccgggtcggcatcgtc
acctgcggcggtctgtgccccgggctgaacaacgtcatccgcgggctggtgctggagctg
acctcgcactaccgcgtccggcggatcttcggattccgcaacggataccagggcttcatc
gcccgctacggccacgacgtcgtcgatctgaccccggagagcgtcgcgaacatcgacgac
gacggcgggacgattctcggcagctcccgcggccagcaggaccccggcgagatcgtcgac
tgtctctcccgcatgaacatcaacattctgttcgtcatcggcggggacggcaccctgcgg
ggcgccaaggaaatctcccgtgtggccaccgaacgcggcgagaagatcgccgtcgtcggc
atcccgaagacgatcgacaacgatatcccctacatcgatcagagctttggctttcagacc
gccttcggcaaggcggccgagtcgatccgtgttgcgcatgccgaggcgacgtccgctccc
ggtggcatgggcgtggtccgcctgatgggccggcattccggcttcatcgcctgttacgcg
accctggcgaagagcaacgccgacgtcgtgctcatcccggagctgccgttcaagctggag
ggcgagggcggcctgctgaactacctgcgccgccgcgtggtcgagcgcgggcacgcggtc
gtcgtcgtcgcggagggcgccggccaggagctcatcaccgaccagcccgagggctccgac
gcgtcgggcaaccgcaagctgcacgacgtcggtccggtgctctcccgccggatcaccgaa
cacttcgccaacgagggcgtcgagctgaacctgaagtacatcgaccccagctacctgatc
cgcagcgtcccggccaacccgtacgacaacgtctacacgatccggctcgctcatgccgcc
gtgcacgccgcgatgtccgggcgcaccgagatggtcgtcggccgctggcgccgccgcttc
atccacattccgatcgccctcgccgtcagccagcgtaaccaggtcgaccccgccggcgac
ctgtggatgtccgtcctcgaagccaccggccagcccccccacttcgagtag

DBGET integrated database retrieval system