KEGG   Frankia alni: FRAAL4566Help
Entry
FRAAL4566         CDS       T00384                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fal  Frankia alni
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FRAAL4566 (glpK)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FRAAL4566 (glpK)
Exosome [BR:fal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FRAAL4566 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4955645..4957207
Genome map
AA seq 520 aa AA seqDB search
MGTPARGSVVAAVDQGTTGTTVCLLDRDATVVGRGYTEIHPQFPRPGWVEQDPEELWRSV
VDTVAAALADAGRRPADLAALGITNQRETTVVWERSSSAPVGPAIVWQDRRTAARCERLA
ADGHAGTVGARTGLVLDPYFSATKIGWILDRDPALRRRAGRGELAFGTVDSWLVWKLTAG
AVHVTDVTNASRTLLLDLAAAAWAPDMLDLFDVPAELLPDVVPSSRVYAETDPDAFLGVR
IPVAAAVGDQQAALFAQGCVEAGQAKNTYGTGSFVLVNTGTAVPPPQSSLLRTIAYQLDG
EPVRYALEGAILSTGAAVGWLRDSLGVIRDAAETADLAASLPGNDGVYFVPALTGLGAPH
WDPRARGTLLGITRGTGRAHLARAVLEGIAYRTRDVVEAMAAAGFAVRELRADGGAARNP
WLMQFQADMLGVDVDVPDNIESTALGSAYLAGLATGFFTDPAALAAHRRSERRYHPAMPA
DRRDRAYRRWRSAVDRARDWADDLDDLDDRDDPAAPAAPR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaccggcgcggggcagcgtggtggccgcggtcgaccagggcaccaccgggacg
accgtctgcctgctcgaccgggacgcaacggtcgtcgggcgcggctacacggagatccat
ccccaattcccccggcccggctgggtcgagcaggatcccgaggagctgtggcgcagtgtc
gtcgacaccgtcgccgcggcgctggccgatgccggtcgccgtcccgcggacctggccgcg
ctgggcatcaccaaccagcgggagaccaccgtggtgtgggagcggtcctcctccgccccg
gtcggtccggcgatcgtctggcaggaccggcgcacggccgcgcgctgcgagcgcctggcc
gccgacgggcacgcgggcacggtcggcgcccgcaccggcctggtcctcgacccatacttc
tccgccacgaagatcggttggattctggaccgcgacccggcgctgcgccggcgggcgggc
cgcggcgaactcgccttcggcaccgtcgactcctggctggtgtggaagctcaccgccggc
gccgtccacgtcaccgacgtcacgaacgcgtcccggacgctgctgctcgacctcgccgcc
gcggcctgggctcccgacatgctggacctgttcgacgtgcccgccgagctgctgcccgac
gtggtgccgagctcccgggtctacgccgagaccgacccggacgccttcctcggcgtgcgg
atcccggtggccgccgccgtcggtgaccagcaggccgccctgttcgcccagggctgcgtc
gaggcggggcaggccaagaacacctacggcaccggctcgttcgtcctggtcaacaccggg
acggcggtgccgccgccgcagtcgtcgctgctgcggaccatcgcctaccagctcgacggc
gagcccgtgcgctacgccctggagggcgcgatcctgtccaccggcgcggccgtcggctgg
ctgcgcgactccctcggcgtcatccgcgacgccgccgagacggccgacctggccgcctcg
ctgcccggcaacgacggcgtctacttcgtcccggcgctgaccggcctcggcgcgccgcac
tgggatccgcgcgcccgcggcaccctgctcgggatcacccgcggcaccggccgggcgcac
ctggcccgcgcggtgctggaggggatcgcctaccggacccgtgacgtcgtcgaggcgatg
gccgccgccggcttcgccgtgcgggagctgcgcgcggacggcggggccgcgcgcaacccg
tggctgatgcagttccaggccgacatgctcggcgtcgacgtcgacgtgcccgacaacatc
gagtccacggcgctcggctccgcgtacctggcgggcctggcgaccggcttcttcaccgac
cccgccgcgctggccgcgcaccggcgcagcgagcggcgctaccacccggcgatgccggcc
gaccggcgcgaccgcgcctaccgccggtggcgctccgccgtcgaccgcgcccgggactgg
gccgacgacctcgacgacctcgacgaccgcgacgaccccgccgcccccgccgcacctcgc
tga

DBGET integrated database retrieval system