KEGG   Frankia alni: FRAAL4586Help
Entry
FRAAL4586         CDS       T00384                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00051  Fructose and mannose metabolism
fal00562  Inositol phosphate metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
fal01230  Biosynthesis of amino acids
Module
fal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fal_M00002  Glycolysis, core module involving three-carbon compounds
fal_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL4586 (tpiA)
   00051 Fructose and mannose metabolism
    FRAAL4586 (tpiA)
   00562 Inositol phosphate metabolism
    FRAAL4586 (tpiA)
Enzymes [BR:fal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FRAAL4586 (tpiA)
Exosome [BR:fal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FRAAL4586 (tpiA)
  Exosomal proteins of bladder cancer cells
   FRAAL4586 (tpiA)
  Exosomal proteins of melanoma cells
   FRAAL4586 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAJ63228
RhizoBase: FRAAL4586
UniProt: Q0RH07
Position
complement(4974801..4975655)
Genome map
AA seq 284 aa AA seqDB search
MMAPLGRGRSERGTEKGKNSVSKDKGTGRRTLVAGNWKMNLNHLEAIALVQKIAFDLKPA
ELETVEVVVIPPFTDLRSVQTLVDGDKLALGYGAQDLSQHGSGAHTGDISGSMLAKLGCS
YVVVGHSERRADHHEDDALVAAKAKAAYAAGITPILCVGEVEEIRAAGTHVEHVLGQLAG
SLAGITAEQAATIVIAYEPVWAIGTGRTASAQDAQDMCAAVRGKLAELYGDAAAAGIRVL
YGGSVKAANAGELFTMPDVDGGLVGGASLVAEEFVGIVRSGPPA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgatggcaccgctgggccggggacgttccgaacggggcaccgagaagggtaagaacagc
gtgagcaaggacaagggcaccgggcggcggacactggtggccggcaactggaagatgaac
ctcaaccaccttgaggccatcgcgctggtgcagaagatcgccttcgatctcaagcccgcg
gagctcgagaccgtcgaggtcgtcgtcattcctccgttcaccgacctgcgcagcgtccag
acgctggtggacggcgacaagctcgcgctcggctacggcgcacaggacctctcccagcac
ggttccggcgcccacaccggcgacatcagcgggtcgatgctggccaagctcggctgctcc
tacgtcgtcgtcggccattccgagcgccgcgccgaccaccacgaggacgacgccctggtc
gccgcgaaggcaaaggcggcctacgccgccgggatcacgccgatcctgtgcgtcggcgag
gtcgaggagatccgcgcggccggcacccacgtcgagcacgtgctgggccagctcgccggg
tcgctcgccgggatcaccgccgagcaggccgcgacgatcgtcatcgcctacgagccggtg
tgggcgatcggcaccggccgcacggcgtccgcccaggacgcccaggacatgtgcgccgcc
gtgcgcgggaagctcgccgagctctacggcgacgcggcggccgcgggcatccgcgtcctc
tacggcggctcggtgaaggcggcgaacgccggcgagctgttcaccatgcccgacgtcgac
ggcgggcttgtcggcggggccagcctcgtcgccgaggagttcgtcggcatcgtgcgcagc
ggcccgcccgcctga

DBGET integrated database retrieval system