KEGG   Frankia alni: FRAAL4586Help
Entry
FRAAL4586         CDS       T00384                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL4586 (tpiA)
   01230 Biosynthesis of amino acids
    FRAAL4586 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL4586 (tpiA)
   00051 Fructose and mannose metabolism
    FRAAL4586 (tpiA)
   00562 Inositol phosphate metabolism
    FRAAL4586 (tpiA)
Enzymes [BR:fal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FRAAL4586 (tpiA)
Exosome [BR:fal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FRAAL4586 (tpiA)
  Exosomal proteins of bladder cancer cells
   FRAAL4586 (tpiA)
  Exosomal proteins of melanoma cells
   FRAAL4586 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4974801..4975655)
Genome map
AA seq 284 aa AA seqDB search
MMAPLGRGRSERGTEKGKNSVSKDKGTGRRTLVAGNWKMNLNHLEAIALVQKIAFDLKPA
ELETVEVVVIPPFTDLRSVQTLVDGDKLALGYGAQDLSQHGSGAHTGDISGSMLAKLGCS
YVVVGHSERRADHHEDDALVAAKAKAAYAAGITPILCVGEVEEIRAAGTHVEHVLGQLAG
SLAGITAEQAATIVIAYEPVWAIGTGRTASAQDAQDMCAAVRGKLAELYGDAAAAGIRVL
YGGSVKAANAGELFTMPDVDGGLVGGASLVAEEFVGIVRSGPPA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgatggcaccgctgggccggggacgttccgaacggggcaccgagaagggtaagaacagc
gtgagcaaggacaagggcaccgggcggcggacactggtggccggcaactggaagatgaac
ctcaaccaccttgaggccatcgcgctggtgcagaagatcgccttcgatctcaagcccgcg
gagctcgagaccgtcgaggtcgtcgtcattcctccgttcaccgacctgcgcagcgtccag
acgctggtggacggcgacaagctcgcgctcggctacggcgcacaggacctctcccagcac
ggttccggcgcccacaccggcgacatcagcgggtcgatgctggccaagctcggctgctcc
tacgtcgtcgtcggccattccgagcgccgcgccgaccaccacgaggacgacgccctggtc
gccgcgaaggcaaaggcggcctacgccgccgggatcacgccgatcctgtgcgtcggcgag
gtcgaggagatccgcgcggccggcacccacgtcgagcacgtgctgggccagctcgccggg
tcgctcgccgggatcaccgccgagcaggccgcgacgatcgtcatcgcctacgagccggtg
tgggcgatcggcaccggccgcacggcgtccgcccaggacgcccaggacatgtgcgccgcc
gtgcgcgggaagctcgccgagctctacggcgacgcggcggccgcgggcatccgcgtcctc
tacggcggctcggtgaaggcggcgaacgccggcgagctgttcaccatgcccgacgtcgac
ggcgggcttgtcggcggggccagcctcgtcgccgaggagttcgtcggcatcgtgcgcagc
ggcccgcccgcctga

DBGET integrated database retrieval system