KEGG   Frankia alni: FRAAL4681Help
Entry
FRAAL4681         CDS       T00384                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fal  Frankia alni
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FRAAL4681 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL4681 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FRAAL4681 (trpB)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FRAAL4681 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5071522..5072679
Genome map
AA seq 385 aa AA seqDB search
MSDPGVSGRFGEFGGRYVPEALVSACEDLEAAYRDARSDPSFTQQLDHLLSVYAGRPTPV
TPANRLSEELGVHLLLKREDLAHTGSHKINNVLGQGLLAQRMGKKRLLAETGAGQHGVAT
ATIGALLGLDVVVYMGEADIQRQALNVFRMELLGATVVPVTSGTRTLKDACSEALRQWVT
QVDEAHYCIGSTMGPHPYPWMVREFQRVIGTEARAQCAGLLRQGVPDVVTACVGGGSNAA
GTFAGFVDTPARLVGVEAAGGAAMTDGLPGILHGFYSNILQDEDGQVREAHSISAGLDYP
GIGPEHAGLGTSGRAEYVTANDEEVVSAVVRLARAEGILPALESAHALAWIIRAAESGEI
PYGSTVLMTLSGRGDKDAEQLRRLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacccgggagtctccggacgcttcggcgagttcggcgggcgatacgtgccggag
gcactcgtctcggcatgcgaggacctcgaagccgcctaccgtgacgctcgctcggacccg
agtttcacgcagcagttggatcatctgctgtccgtgtacgcgggccgcccgacgcccgtc
acgcccgcgaaccggctgtccgaggagctcggcgtgcacctgctgctgaagcgcgaggat
ctggcccacaccgggtcccacaagatcaacaacgtcctggggcagggactcctcgcccaa
cggatggggaagaagcgactgctcgccgagaccggcgcggggcagcacggcgtcgcgacg
gccaccatcggcgcccttctcggcttggacgtggtcgtctacatgggcgaggcggacatc
cagcgccaggcattgaacgtctttcgcatggagctgctcggcgccacggtggtgccggtg
acaagcggcacgcggacgctcaaggacgcctgtagcgaggcgctgcggcagtgggtcacg
caggtcgacgaggcccactactgcatcggatccaccatgggccctcatccctacccgtgg
atggtgcgcgagttccagcgagtgatcggaaccgaggcgcgggcgcagtgcgccggactc
ctccgccagggcgtgcccgacgtcgtgaccgcctgtgtcggcggtgggtcgaacgccgcg
gggacgttcgccgggttcgtcgacacgccggccaggctggtcggcgtggaggcagccgga
ggcgccgcgatgaccgacggcctgcccggtattctccacggcttctactcgaacatcctc
caggacgaggacggccaggtccgggaggctcactccatctcggcggggctggactatccg
ggaatcggacccgaacatgccgggctcggcacctcgggccgcgccgaatatgtgacggcg
aacgatgaggaggtcgtctccgcggtggtccggctggccagggccgagggcatcctgccc
gcactcgagtccgcccatgctctcgcgtggatcattcgggccgccgagtccggcgagatc
ccgtatggatcgacggtcctgatgaccctgtccggacggggcgacaaggacgccgaacaa
ctgaggaggctcgtgtga

DBGET integrated database retrieval system