KEGG   Frankia alni: FRAAL4682Help
Entry
FRAAL4682         CDS       T00384                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fal  Frankia alni
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FRAAL4682 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL4682 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FRAAL4682 (trpA)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FRAAL4682 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
5072739..5073533
Genome map
AA seq 264 aa AA seqDB search
MGGKCLVPYVTAGITESWLDYVAAAQDGGADAVEIGLPFSDPMLDGPIIQAASSRALVRG
STVGGLLDELAGFRAEVPLIVMTYSNIARRHGYDDFCHRLAEAGLAGLIVADTPVDEVRP
LVDSATSAGLELTMLVAPSTSPDRVRQIGATSRGFVYVVSIMGVTGVRDTVSDSIVGTVQ
GVRDATMMPVLVGFGVSTPEQAATVASVADGVVVASALMRSILDGAPAGGIRREVDALRV
AVDSAAAVRPTDIAPGRRAPTGNR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggcaagtgcctcgtaccgtacgtcaccgcggggatcacggaaagttggctcgac
tacgtggccgccgctcaggacggtggcgcggacgcggtcgagatcgggttgccgttctcg
gaccccatgctggacggccccatcatccaggcagcctcgtcacgggcactggttcgaggc
agcaccgtcggggggctgctcgacgagctggccggcttccgcgccgaggtcccgctgatc
gtcatgacctacagcaacattgcccggcggcacggatacgacgatttctgccaccggctg
gcggaggcgggcctggccggactgatcgtcgcggacaccccggtcgacgaggtccgccct
cttgtcgactccgccacgagcgccgggctcgagctgacgatgctggtcgcaccgtcgacc
agcccggaccgcgttcggcagatcggggcgaccagccggggcttcgtgtatgtggtcagc
atcatgggagtcaccggcgtgcgcgacaccgtatcggactcgatcgtcgggacggtgcag
ggtgtccgagacgccaccatgatgcccgtactggtgggtttcggcgtctcgacccccgaa
caggcggccacggtcgcaagcgtggcagacggtgttgtcgtggcgtcggccctcatgcgt
tcgattctcgacggcgcccccgcgggcgggattcgacgcgaggtcgacgccctgcgcgtc
gccgtcgactccgcagccgcagtccgaccgaccgacatcgcgccggggaggagggccccg
acggggaaccgatga

DBGET integrated database retrieval system