KEGG   Frankia alni: FRAAL4922Help
Entry
FRAAL4922         CDS       T00384                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fal  Frankia alni
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FRAAL4922
Enzymes [BR:fal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     FRAAL4922
Peptidases [BR:fal01002]
 Cysteine Peptidases
  Family C44
   FRAAL4922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5332679..5334550)
Genome map
AA seq 623 aa AA seqDB search
MTTPITVRLPGPDTRLASCRPSCWFVVLADRDPVVLPAGVRRVLRYPSGRPWVVGDWPDE
AMISAETSRARMALVGRVAASSSQLLRLLIAARDVHSLDVAHAVAGDYHVIAEINGQRRL
QGSPTGTRRIFTAMSRGQHVAADRADILAELAGGALDRTALALSLLDPCPPYPLDDLVPW
ASVETVPPDHYLFLDRDGRVERMRWWRQPAPVRSRAEGAPILRAALAEAVSVRVAAGRAV
SADLPGGLASAAVCCLAARGPADIVAVTGVARDSDGPDSCWAADAAVSLPGVVREILSAG
ELPPAFDGITSADEALDHPFVGLVDRATLRAGLDRVALYGPRLHLTGLGGVEVTQGALNY
LPRLARRRPWTALRHLSGLHTQAGWPWAAGLRMMRRRSYRDCMGDLARALDQAPLGGRPA
RPRPPDPTAALDWTPAPVVPDWLTPAALRLIVEAVADAAHRDGPLAPTRDGHADLFAIRT
TASAFRLFDQMASPVGPPLSAPFLDDRVVRAALAVRAEERASPWEDGPLLKEAMQQVVPA
NCLRGEISGGADADAEQIRGLHANRGALVGLCDDSPLADLGLIEPEMLREACREGAAADR
RPQPLRPTFAADAWLRTLTGRRG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgcccatcacagtgcggctgccgggccccgacacgcggctggcgtcctgtcgg
ccgagctgctggtttgtcgttctggcggatcgggatccggtcgtgctgcccgcgggggtc
cggcgagtgctgcgatacccctcggggcggccgtgggtcgtgggcgactggccggacgaa
gcgatgatcagtgcggagaccagtcgcgcccggatggccctggtcggccgagtcgcggcg
agttccagccagctcctgcgcctgctgatcgccgcgcgggacgtgcactccctcgacgtc
gcgcacgccgtggccggggactaccacgtcattgccgagatcaacgggcagcgcaggctg
caggggagcccaaccggcacgcgtcggatcttcaccgcgatgtccaggggtcagcacgtc
gccgccgaccgcgccgacatcctggccgagctggccggcggtgcactggaccgcacggcg
ctggccctgtcgctgctggatccatgcccgccgtacccgctcgacgaccttgtcccctgg
gcgtcggtcgagaccgtgccacccgaccactacctgtttctcgatcgtgacggacgggtc
gagcggatgcgctggtggcggcagccggcgccggtgcgctcgcgcgccgagggcgcgccg
atcctacgagcggccctcgccgaggcggtgtccgttcgggtggctgcggggcgcgccgtc
agcgccgatctgcccggcgggctggcttcggccgctgtgtgctgcctggcggcccgcggc
cccgccgacatcgttgcggtcacgggggtcgcccgggactccgatggtcccgattcatgc
tgggcagccgacgcggcggtctcgttgcccggagttgtccgggagattctgtccgcaggt
gagcttccgccagccttcgacggcatcacctccgccgacgaggcgctcgaccatcccttc
gtcggcctcgtggatcgggcgacgctgcgggcgggactcgaccgcgtcgcactctacgga
cctcggctacacctgaccggcctcggaggcgtggaggtgacacagggcgcactgaactac
ctgcctcgactcgcccgccggcggccctggaccgcgttgcggcacctgagcggcctgcac
acccaggcaggttggccgtgggccgcgggcctgcggatgatgcgccgtcggagctaccgc
gactgcatgggcgacctcgcccgggcgctcgaccaggctccgctcgggggacgccccgca
cggccgcggccacccgacccgacggcggccctggactggacgccggcgccggtcgtcccg
gactggctgacccctgccgccctgaggctcatcgtcgaggccgtcgccgacgcggctcac
cgagacggtcccctcgcgccgacgcgggacggccacgccgacctgttcgcgattcggacc
accgcgtccgccttccggctgttcgaccagatggccagcccggtcggcccgccgttgagc
gcgccgttcctcgacgaccgggtagtccgcgccgcgctcgccgtccgggcggaggagcgc
gcctccccctgggaggacgggccgctgctcaaggaggcgatgcagcaggtggtaccggcg
aactgcctgcgtggggaaatctcgggtggcgccgatgccgatgccgagcagatccgaggg
ctgcacgccaatcgtggcgccctggtcgggctgtgcgacgactcgccgttggccgacctc
ggactcatcgagccggagatgctccgggaggcgtgccgtgagggggccgcggcggaccgc
cggccccagcccctccgaccgaccttcgcggccgacgcgtggctacgcaccctcaccggc
cgtcggggctga

DBGET integrated database retrieval system