KEGG   Frankia alni: FRAAL4941Help
Entry
FRAAL4941         CDS       T00384                                 

Definition
guanidinoacetate N-methyltransferase (EC:2.1.1.2)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5352674..5353468)
Genome map
AA seq 264 aa AA seqDB search
MTLNPTAQSLLAPMSAEPRQFLLDRALDEFVADLGALDEAAEAMVPGAARPRIDTAIDAA
APAVVDGTLLVSGQEVMQTWEAPLMRALAQAVTTPGGTVLEIGFGLGLSAGFVQEVGPAR
HVIVEANPQTAAVAEQWARAAGRRGVEIVTGRWQDALAELGRFDGVLFDTYPMDEAEVDE
YVMRDATFAEHFFAPAASALTGGGAFTYYSNEIDSVSRRHQRALLRHFRTFAVEIVDGLR
PPEDCSYWWAPSMAVIVARGPRRS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaaccccaccgcgcagtccctgctcgctccgatgtccgccgagcctcgccag
ttcctgctggaccgggccctggacgagttcgtcgcggacctcggcgcgctggacgaggcg
gccgaggccatggtgccgggcgccgcccgcccgcgcatcgacaccgccatcgacgcggcc
gcgcccgcggtggtcgacggcaccctgctcgtctccggccaggaggtgatgcagacctgg
gaggcaccgctgatgcgggcgctggcccaggcggtcacgacgccggggggaacggtgctg
gagatcgggttcggtctcgggctgtccgccgggttcgtgcaggaggtcgggcccgcccgt
cacgtcatcgtggaggcgaacccgcagaccgccgcggtcgccgagcagtgggcgcgggcc
gccggccggcgtggcgtggagatcgtcaccgggcgctggcaggacgccctcgccgagctc
ggccggttcgacggcgtcctgttcgacacctatcccatggacgaggccgaggtcgacgag
tacgtcatgcgcgacgcgaccttcgccgagcacttcttcgcaccggccgcgtcggccctg
accggcggcggcgcgttcacctactactccaacgagatcgactcggtctcccggcgacac
cagcgcgcgctgctgcgccacttccgcacgttcgcggtcgagatcgtcgacggcctgcgc
ccacccgaggactgcagctactggtgggcgccctcgatggccgtcatcgtggcccgtggc
ccgcgccggtcctga

DBGET integrated database retrieval system