KEGG   Frankia alni: FRAAL4955Help
Entry
FRAAL4955         CDS       T00384                                 

Gene name
celA1
Definition
endoglucanase A (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fal  Frankia alni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FRAAL4955 (celA1)
Enzymes [BR:fal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FRAAL4955 (celA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5372987..5374597)
Genome map
AA seq 536 aa AA seqDB search
MAATGRGARAQRRGLNVRLNVRLNVRLNARLNARLNADRLSAPPGRGREVSRYGRFPGTR
RCVAIVAVDMLFPDIGALRVNAARSRAFGGRVSDASGHRRHRRPTPAVGRVPAAAGAARG
HHGRFFALLWPFAALMVCAGFGLEQLVIEPAYGSSGGSSTVAAQPGIITLTPAPAPAEPT
LASSGPVPGAKVGVALAPAARATRPVASASPAVTVVGPTVAGAGGSGTPTGAAALPAVVA
ATAGDPFAAATLYVDPAGDAAQAVRTLRQSDPAGAQTLSRLADRSHADWFGDPDPATVRT
RVADRVRVVRAAGALPVLVAYAIPQRDCGGGQSAGGVGGESAYRAWIAAFAAGIGSGPAA
VILEPDALAQIDCLAPAAATARYAMLGYAVDQLAAVGAEVYLDAGNASWHSVADTAARLR
QAGVARARGFALNVSNFDETADETAYGDAVVAALGGTAHYVVDTSRNGRGPAADNAWCNP
PGRGLGVAPSGRTGNPRADAYLWIKVPGESDGACNGGPAAGGWWLDYALGLASRAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcaacaggccgcggagctcgtgcgcaacgccgcgggctgaacgtccgactgaac
gtccgactgaacgtccgactgaacgcccgactgaacgcccggctgaacgccgaccggtta
tccgcgccccccggacgggggagggaagtctcccggtacggcagattccccggtacccgc
cggtgtgtcgccattgtggcggtcgatatgctctttcccgacatcggggcactgcgcgtc
aacgccgcgcggtcgcgtgcattcggaggtcgtgtgtcggacgcctcggggcaccgccgt
catcgtcgtcccaccccggcggtgggccgggtcccggcggccgcgggcgccgcgcgaggt
caccacggccggttcttcgcgttgctctggccgttcgcggcgctcatggtgtgcgccggc
ttcgggctggaacaactcgtcatcgagccggcctacgggtcctcgggcggatcgagcacg
gtcgccgcgcagcccggcatcatcaccctcacccccgccccggcgccggcggagccgaca
ctcgcctcgtcgggcccggtcccgggggcgaaggtcggcgtggccctcgcgcccgccgcc
cgtgccacccggccggtggcgtcggccagcccggcggtcacggtggtcgggcccaccgtc
gcgggcgccgggggttccggcacgccgaccggcgccgcggcgctgccggcggtcgtcgct
gcgacggccggcgacccgttcgccgccgcgaccctctacgtcgatcccgccggtgacgcg
gcccaggcggtgcgcacattgcgccagagcgatcccgccggcgcgcagacgctgtcccga
ctggccgaccgctcccacgcggactggttcggcgatccggatcccgccaccgtgcgcacc
cgcgtcgccgaccgggtccgggtggtgcgggcggccggcgcgctgcccgtgctcgtcgcc
tacgcgatcccgcagcgcgactgcggcggtggccagtcggcgggcggggtcggcggcgag
tccgcctaccgggcctggatcgccgccttcgccgccggcatcggctccggccccgccgcg
gtcatcctggagccggacgccctggcccagatcgactgcctggcgccggccgccgccacc
gcccggtacgccatgctcggctacgccgtcgaccagctcgccgcggtcggggccgaggtt
tacctcgacgccggcaacgcctcctggcattcggtcgccgacaccgccgcccggctgcgc
caggccggcgtcgcccgggcccggggcttcgccctcaacgtgtcgaacttcgacgagacc
gccgacgagacggcctacggcgacgcggtcgtcgccgccctcggcggcaccgcccactac
gtcgtcgacacctcccgcaacggtcgggggccggcggccgacaacgcctggtgcaaccca
cccggccgaggcctgggcgtggctcccagcggccggacgggcaacccgcgcgccgacgcc
tacctctggatcaaggtgcccggcgagtccgacggcgcgtgcaacggcggcccggccgcc
ggcggatggtggctcgactacgccctgggcctggcgagcagggccgcgtga

DBGET integrated database retrieval system