KEGG   Frankia alni: FRAAL4956Help
Entry
FRAAL4956         CDS       T00384                                 

Gene name
celA2
Definition
endoglucanase 1 (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fal  Frankia alni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5374552..5375814)
Genome map
AA seq 420 aa AA seqDB search
MPTSRSRVAAPTPPGGDRVRPAWPRRAPAPRGRAGRAWRPRAGGRPRGVAAVLALVAALV
VTLVGCGPGGGKSAGGAGGAGGAVGAAGATTAVPAPDPTRCPAGGGAGGGPSLAGGEAAA
GSADGAAARGRAPRGPFLVDPAGQAAQQAQAHPAEAAAIAPLVQTSSAFPVGDWVTDVVG
EVHSRAAAAEATGATAVYMVYAIPHRDTGGVYSAGGLPDAAAYRQFTRQVAAGIGGAAAV
IVLEPDALGQIDRLDAAQAAERYALLRDAVDVYGALPATSVYLDGANCGWIAPAVMAGRL
AQAGIAHARGFAVNVANYYRTEDEAARAEVLSRFVGGAHYVVDTSRNGRGPAVGLTNPWC
NPPGRGLGEKPTTSTGYPHADAFLWVKTPGASDGECGRGDPTAGAWWPQQAAELVRNAAG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacgtccaggtcccgggtcgccgcgcccacgccgccgggcggcgaccgggtgcgg
ccggcctggccgcgccgggccccggccccgcgtggccgggcagggcgggcctggcgcccg
cgcgccggcgggcgaccccgcggggtcgccgccgtcctcgccctggtcgcggcgctggtc
gtcacgctggtcgggtgcggcccgggcggggggaagtcggccggcggcgccggcggggcc
ggcggggccgtgggcgcggccggtgccacgactgcggtgcccgccccggacccgacccgc
tgccccgcgggcggcggtgccgggggcggtccgtcccttgccggcggcgaggccgccgcc
gggtcggccgacggcgccgccgcgcggggccgcgcgccccggggtccgttcctggtcgac
ccggccggccaggcggcgcagcaggcccaggcacacccggccgaggccgcggccatcgcc
ccgctcgtgcagacctcgagcgccttcccggtcggcgactgggtgaccgacgtcgtcggt
gaggtccacagccgggccgccgcggcggaggcgaccggcgccaccgccgtgtacatggtc
tacgccatcccgcaccgggacaccgggggcgtctactccgccggcgggctgcccgacgcc
gccgcctaccgccagttcacccgtcaggtcgccgcgggtatcggcggcgcggcggcggtc
atcgtgctcgaacccgacgcgctcgggcagatcgaccggctcgacgccgcccaggcggcg
gaacgctacgcgctgctgcgtgacgcggtcgacgtgtacggcgcgctgccggcgaccagc
gtctacctggacggcgcgaactgcggctggatcgccccggcggtcatggccgggcggttg
gcgcaggccgggatcgcgcacgcccgcggcttcgccgtcaacgtggcgaactactaccgc
accgaggacgaggccgcccgcgccgaggtcctctcccggttcgtcgggggggcgcactac
gtcgtcgacacctcccgcaacggccgcggaccggcggtggggctgacgaacccgtggtgc
aacccgccgggtcgcggcctcggcgagaaacccacgaccagcacgggatatccgcatgcc
gacgcgttcctctgggtgaagacgcccggcgccagcgacggggaatgcggccggggcgat
ccgacggcgggcgcatggtggccgcaacaggccgcggagctcgtgcgcaacgccgcgggc
tga

DBGET integrated database retrieval system