KEGG   Frankia alni: FRAAL4967Help
Entry
FRAAL4967         CDS       T00384                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fal  Frankia alni
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FRAAL4967 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL4967 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FRAAL4967 (trpA)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FRAAL4967 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(5393865..5394692)
Genome map
AA seq 275 aa AA seqDB search
MQSRLDERFTAAREEGRSLLVGYLPAGYPTVDGAVAAMRAMVAAGVDVVEVGLPYSDPTM
DGPVIQDAADAALRGGVTTVDVLRTVEAVAATGAPTVVMTYWNPIDRYGPARFAADLAAA
GGAGTITPDLPPEEADPWLAASAEHGLDPVFLVAPSSSDARIRRVTGISRGFVYAASLMG
VTGTRAAVGSQAADLVARVRATTELPVAVGLGVSTGAQAAEVAGFADGVIVGSALVKVLV
DAQRSGTGDAAALAGIGRLAAELAEGVRAPVPASA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgcagagtcggttggacgagcgtttcacggccgcccgcgaggagggtcgatccctgctg
gtcggctacctgccggcaggctacccgacggtcgacggcgcggtcgcggccatgcgggcg
atggtcgcggcgggcgtcgacgtcgtcgaggtgggcctgccctactcggacccgaccatg
gacgggccggtgatccaggacgccgccgacgcggcgctgcgtggcggggtgacgaccgtg
gacgtgctgcgcaccgtcgaggcggtcgccgccaccggtgcgccgaccgtggtcatgacc
tactggaacccgatcgaccgttacggcccggcgcggttcgccgccgacctcgccgcggcc
ggcggagcggggacgatcaccccggacctgccgcccgaggaggcggacccctggctcgcg
gcgagcgcggagcacgggctggacccggtgttcctcgtcgcgccgagctcctcggacgcc
aggatccggcgggtcaccgggatctcccgcgggttcgtctacgccgcctcgctgatgggc
gtcaccggcacccgcgccgcggtcggcagccaggccgccgatctggttgcccgggtgcgg
gccaccaccgagctgccggtcgcggtcggcctcggggtgagcaccggcgcgcaggccgcc
gaggtcgccgggttcgccgacggggtgatcgtcggttcggcgctggtcaaggtgctggtg
gacgcgcagcgctcgggcaccggcgacgccgccgccctcgccggcatcggccggctggcc
gccgagctcgccgaaggggtgcgtgcccccgtcccggcctcggcctga

DBGET integrated database retrieval system