KEGG   Frankia alni: FRAAL4968Help
Entry
FRAAL4968         CDS       T00384                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fal  Frankia alni
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FRAAL4968 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL4968 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FRAAL4968 (trpB)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FRAAL4968 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5394741..5396063)
Genome map
AA seq 440 aa AA seqDB search
MATRTAAQPAPAETATSTPSAEAVRAQAENWQVFPDPAGHFGRFGGRFVPEALMAALDEL
TEAYDQARADEGFVAELDDLLATYAGRPTPLTDAHRLTEHVGGARILLKREDLAHTGSHK
INNVLGQCLLTRRMGKTRVIAETGAGQHGVATATACALLGLECVVYMGEEDTRRQALNVA
RMRLLGAEVVPVASGSRTLKDAINEAMRDWVATVEHTHYCIGSVMGPHPFPMMVRDFQRI
IGVEARAQVLERTGRLPDAVVACVGGGSNAMGIFHPFIPDTGVALIGCEAGGDGVATGRH
AAAIAGGSSGVLHGMRTFLLQDEFGQTQVSHSISAGLDYPGIGPEHALLHETGRASYRVV
DDAAAMAALALVARTEGILVAIESAHAFAGAFDVARELGPDATVVVNCSGRGDKDVDTAA
RWFGLLDDAGGAAADADPRG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggctacccgaactgctgcccagccagctcccgccgagaccgcgacctcgacgccgtcc
gccgaggccgtccgggcgcaggcggagaactggcaggtgtttcccgatcccgcggggcac
ttcggccggttcggcgggcggttcgtgcccgaggcgctcatggcggccctcgacgagctg
accgaggcctacgaccaggcccgggccgacgagggcttcgtcgccgagctcgacgacctg
ctcgccacctacgccgggcggcccacgccgctgaccgacgcgcaccggctcaccgagcac
gtcggcggcgcccgcatcctgctcaagcgcgaggatctcgcccacaccggctcccacaag
atcaacaatgtgctcgggcagtgcctgctgaccaggcggatgggcaagacccgggtcatc
gccgagaccggcgccggccagcacggggtggccaccgccaccgcgtgcgccctgctcggc
ctggagtgcgtggtctacatgggcgaggaggacacccgccggcaggcgctcaacgtcgcc
cggatgcgcctgctcggcgccgaggtcgtcccggtcgcctccggcagccgcaccctcaag
gacgcgatcaacgaggcgatgcgcgactgggtcgccaccgtcgagcacacccattactgc
atcggttcggtgatgggcccgcacccgttcccgatgatggtgcgggacttccagcgcatc
atcggcgtggaggcccgggcccaggtgctcgagcgcaccggccggctgcccgacgcggtc
gtcgcctgcgtcggcggcggctccaacgcgatgggcatcttccacccgttcatccccgac
accggcgtggcactgatcggctgcgaggccggcggggacggggtggccaccgggcggcac
gccgcggcgatcgccggcggctcctcgggcgtgctgcacggcatgcggaccttcctgctg
caggacgagttcggccagacgcaggtgtcccactcgatctccgccggcctggactacccg
ggcatcggccccgagcacgcgctgctgcacgagaccggccgggcaagctaccgcgtcgtc
gacgacgcggcggcgatggcggcgctcgcgctggtcgcccgcaccgagggcatcctggtc
gcgatcgagagcgcgcatgccttcgccggcgcgttcgacgtcgcccgcgagctcggtccg
gacgcgaccgtcgtggtgaactgctccgggcgcggtgacaaggacgtcgacacggccgcc
cgctggttcggcctgctcgacgacgcgggcggcgccgccgccgacgcggatccgcgcggc
tga

DBGET integrated database retrieval system