KEGG   Frankia alni: FRAAL5084Help
Entry
FRAAL5084         CDS       T00384                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase 1 (Phosphofructokinase 1) (Phosphohexokinase 1) (ATP-PFK)
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00030  Pentose phosphate pathway
fal00051  Fructose and mannose metabolism
fal00052  Galactose metabolism
fal00680  Methane metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5084 (pfkA)
   00030 Pentose phosphate pathway
    FRAAL5084 (pfkA)
   00051 Fructose and mannose metabolism
    FRAAL5084 (pfkA)
   00052 Galactose metabolism
    FRAAL5084 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    FRAAL5084 (pfkA)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FRAAL5084 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     FRAAL5084 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAJ63724
RhizoBase: FRAAL5084
UniProt: Q0RFL8
Position
complement(5520054..5521079)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGESVYGHSFVGFRDGWRGPLTGDTVPLDTAAVRGI
LPRGGTILGSSRTNPYAAVDGPSLIRENLAAAEIDALVAIGGEDTLGVAAQLHAEGLPVV
GVPKTIDNDLFATDYTFGFDTAVNIATEAIDRLHTTAESHHRVLIVEVMGRHAGWIALHS
GMAGGANVILIPERPFDFDKVCAFVEARFATHYAPIIVAAEGATPIAGTLVTREGELDAF
GHVRLQGIAQVLETEIRGRTGRDARATVLGHLQRGGTPTAFDRWLATRFGLHAVDAVHEG
DFGVMVALHGTRIDRVPLAEATRELKTVPEELYNEAETFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcggtgtactgaccggtggcggcgactgtcccggactcaacgcggtgatcagg
gccgtcgtccgcaagggcgagagcgtctacgggcacagcttcgtggggttccgggacggc
tggcgcgggccgctgaccggtgacacggtgccgctcgacaccgccgccgtacggggcatc
ctgccgcgcggcgggaccatcctcgggtcgagccgcacgaacccctacgccgccgtggac
gggccgtcgctcatccgcgagaacctggccgccgccgagatcgacgcgctcgtcgcgatc
ggcggcgaggacaccctcggcgtggccgcccagctccacgccgagggtctgcccgtggtc
ggggtccccaagaccatcgacaacgacctgttcgccaccgactacaccttcggcttcgac
accgccgtcaacatcgccaccgaggcgatcgaccgcctccacaccaccgcggagagccac
caccgcgtgctcatcgtcgaggtgatgggacgccatgccggctggatagcgctgcacagc
ggcatggccggcggcgcgaacgtcatcctcatcccggaacggccgttcgacttcgacaag
gtctgcgccttcgtcgaggcccgcttcgcgacccactacgccccgatcatcgtcgccgcg
gagggcgcgaccccgatcgccggcaccctggtcacgagggagggcgagctcgacgccttc
ggccacgtccgtctgcagggcatcgcgcaggtgctcgagaccgagatccgcggccgcacc
ggccgggacgcccgcgccaccgtgctcggccatctccagcgtggtggcacgccgaccgcg
ttcgaccgctggctcgcgacgcgcttcggcctgcacgccgtcgacgcggtgcacgagggc
gacttcggggtgatggtcgccctgcacgggacccgcatcgaccgcgtgccgctggcggag
gcgacccgtgagctcaagacggtgcccgaggagctctacaacgaggcggagaccttcttc
ggctga

DBGET integrated database retrieval system