KEGG   Frankia alni: FRAAL5088Help
Entry
FRAAL5088         CDS       T00384                                 

Definition
esterase/lipase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fal  Frankia alni
Brite
Enzymes [BR:fal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     FRAAL5088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5525015..5525812
Genome map
AA seq 265 aa AA seqDB search
MAGSTGTAVLPGAEPFEFAGGPVGVLLVHGFTGSPGSMRPWGESLAAAGLTVSCPLLPGH
GTRWQDMVPTTWPDWYATVQGAFLRLRADCEQVFVMGLSMGGTLTLRLAEEHGSDLAGVV
TVNASLSTERWHAALAPLLGRFIPAVRGVAGDVKAKGVPEVGYDRVPLLAFASLRKLWGV
TRGDLGRIECPVLAYRSVVDHVVEPSSGAILLAGVRAPIEERLLPDSWHVATLDNDKETI
FKGSLDFVQQHAARALVPDTPRDDG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctccaccggcacagccgtcctacccggtgccgaaccgttcgagttcgcgggt
ggcccggtgggcgtcctgctcgtccacgggttcaccggctcgccgggcagcatgcggccc
tggggcgagtccctcgccgccgccgggctgaccgtctcctgcccgctgctgccgggccac
ggcacccgctggcaggacatggttcccaccacctggccggactggtacgccaccgtgcag
ggcgcgttcctgcgcctgcgggcggactgtgagcaggtgttcgtcatgggcctgtcgatg
ggcgggacgctgacgctgcggctggccgaggagcacggctccgacctcgccggcgtggtc
accgtgaacgcgagcctgtcgaccgagcggtggcacgcggcgctcgccccgctgctcggg
cggttcatcccggccgtgcgcggcgtcgccggcgacgtgaaggccaagggcgtgcccgag
gtcggttacgaccgggtgccgctgctcgcgttcgcctcgctgcgcaagctgtggggggtg
acccgcggcgacctcgggcggatcgagtgtccggtgctcgcgtaccgcagcgtcgtcgat
cacgtggtcgagccgagctcgggggcgatcctgctggccggggtgcgcgcgccgatcgag
gaacggctgctgccggacagctggcacgtggcaaccctcgacaacgacaaggaaacgatc
ttcaaaggcagtctggacttcgtccagcagcatgcggcgcgcgcgctcgtgcccgacacc
ccccgcgacgatggctga

DBGET integrated database retrieval system