KEGG   Frankia alni: FRAAL5091Help
Entry
FRAAL5091         CDS       T00384                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL5091
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5091
   00052 Galactose metabolism
    FRAAL5091
   00500 Starch and sucrose metabolism
    FRAAL5091
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL5091
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FRAAL5091
   00524 Butirosin and neomycin biosynthesis
    FRAAL5091
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FRAAL5091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5528418..5529341)
Genome map
AA seq 307 aa AA seqDB search
MDVGGTKVAAGVVDGAGTVLASVRRPTPGHSASEVADTIAAVVAELSADYEVKAVGIGAA
SWIDADRSRVLFAPNLAWRDEPLRDEVSGRVGLPVVVENDANAMAWAEYRFGAGRGRRDL
VCLTVGTGIGSGIVLGGELYRGAFGIGAETGHMRMVPDGHLCGCGNRGCWEQYASGRALV
RAARQIAATDPSAAASMLEACGGDAERLTGPDVTEAARKGDAAAIRCLTEIGHWLGEGMA
TLTAVLDPDRFVIGGGVSDSGDLLLGPARERFAQTVPGRAHRPPAEVVIAELGSQAGLVG
AADLARI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcggggggacgaaggtcgccgccggcgtcgtcgacggcgccggcaccgtcctc
gcgtcggtccggcgcccgactcccggtcattcggcgtccgaggtcgcggacaccatcgcc
gccgtggtggcggagctcagcgccgactacgaggtgaaggcggtcggcatcggcgcggcc
agctggatcgacgcggaccgctcgcgggtcctgttcgctcccaacctcgcctggcgcgac
gagccgctgcgcgacgaggtgagcggccgcgtcgggctgcccgtcgtcgtcgagaacgac
gccaacgcgatggcctgggccgagtaccggttcggtgccgggcgggggcgccgtgacctg
gtctgtctcacggtgggcacgggtatcggcagcggcatcgtcctcggtggcgagctctac
cgcggcgcgttcggcatcggcgcggagaccggccacatgcggatggtgcccgacggccac
ctgtgcgggtgcggcaaccgcggctgctgggagcagtacgccagcggtcgggcgctggtc
cgcgccgcgcgccagatcgcggcgacggatccgtccgcagccgcgtcgatgttggaggcg
tgcgggggtgacgccgagcggctgaccggcccggatgtcaccgaggcggcccgcaagggg
gacgcggcggcgatccgctgcctgaccgagatcggccactggctcggcgagggcatggcg
actctgaccgccgtgctggacccggaccgtttcgtcatcggcggcggggtgtcggactcc
ggcgacctgctgctcggcccggcccgggagcggttcgcccagacggtgcccggccgcgcg
catcggcccccggccgaggtggtcatcgccgagctcggttcccaggccggtctcgtcggc
gccgccgacctcgcccggatctga

DBGET integrated database retrieval system