KEGG   Frankia alni: FRAAL5152Help
Entry
FRAAL5152         CDS       T00384                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase, component of 2-oxoglutarate dehydrogenase complex (E2) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fal  Frankia alni
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL5152 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRAAL5152 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FRAAL5152 (sucB)
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FRAAL5152 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5584285..5585790
Genome map
AA seq 501 aa AA seqDB search
MRGACRMRRRSRSSMSVSVTMPRLGESVSEGTVTRWLKQEGERVEADEPLLEVSTDKVDT
EIPAPASGVISSIKVAEDETVEVGVELAVIDDGSGGGSAAAAPTEAPAPAAEPEPEPEPA
KPVAAAPPPPPAPTPAPAPAPVRAPEPAPVPAQAPTAPAPVATSNGDGGIGRYVTPLVRK
MAAELGVDLADVNGSGPGGRITKQDIQEAARSGGAPAAPAPAAAPAAPAAPSAPARPAAP
TAAPAASAPKASGAGTSTPAPVRGRTEKLSRLRALVAKRMVESLQISAQLTTVVEVDVTR
IARLRDRAKAGFQAREGLKLSFLPFFALATCEALREFPQLNASLDVEAGTVTYHGEENLG
IAVDSERGLVVPVIHSAGDLNLTGLARKIDDLASRTRANKISPDELGGGTFTLTNTGSRG
ALFDTPIINQPQVGILGTGIVTKKPAVIDDPELGEIIAVRSAVYLSLTYDHRIVDGADAA
RFLTFIKRRLEEGAFEADLGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcggtgcatgccggatgcgacgaaggagtcgttccagcatgtctgtatctgtcacg
atgccccggctcggggaaagtgtctccgagggaaccgtcacccgttggctgaagcaggag
ggtgagcgcgtcgaggccgacgagccgctcctcgaggtcagcacggacaaggtcgacacc
gagattcctgcccccgcctccggtgtcatcagctccatcaaggtcgcggaggacgagacc
gtcgaggtcggcgtcgaactcgcggtcatcgacgacggctccggcggcggttccgccgcg
gccgcccccaccgaggcccccgcccccgccgcggagcctgagccggagcccgagccggcc
aagcccgtcgccgcggcgcccccgcccccgcccgcacccaccccggcccccgcgccggcg
ccggtccgcgcgccggagccggccccggtgcccgcccaggccccgaccgcgcccgccccg
gtggccacgtccaacggcgacggcgggatcggtcgctacgtcacgccgctggtccgcaag
atggccgccgagctgggcgtcgacctcgccgacgtgaacggctcgggccccggcggccgg
atcaccaagcaggacatccaggaggcggcccgctccggcggcgccccggccgctcccgcg
cccgccgccgccccggcggctccggccgcgccgtcggcaccggcccgccccgcggcgccg
accgcggccccggccgcgtccgccccgaaggcgagcggcgcgggcacctccacccccgcc
ccggtccgcgggcgcaccgagaagctctcccggctgcgcgccctggtcgccaagcgcatg
gtcgagtcgctgcagatcagcgcccagctcaccaccgtcgtcgaggtggacgtcacccgc
atcgcgcggctgcgggaccgggccaaggccggcttccaggcccgcgagggactgaagctg
tcgttcctgccgttcttcgcgctggcgacctgcgaggcgctgcgcgagttcccgcagctc
aacgccagcctcgacgtcgaggcggggacggtcacctaccacggcgaggagaacctcggc
atcgccgtggactccgagcgcggcctggtcgtaccggtcatccacagcgccggtgacctc
aacctcaccggtctcgcccgcaagatcgacgacctggccagccggacccgggccaacaag
atctccccggacgagctcggcggcgggaccttcaccctcacgaacaccggcagccggggc
gccctgttcgacactccgatcatcaaccagccgcaggtcggcatcctcggcacggggatc
gtgacgaagaagcccgccgtcatcgacgaccccgagctcggcgagatcatcgccgtccgg
tcagcggtgtacctgtcgctgacctacgaccaccgcatcgtcgacggggccgacgccgcc
cgcttcctgaccttcatcaagcggcggctcgaggagggcgcgttcgaggccgacctcggc
ctctag

DBGET integrated database retrieval system