KEGG   Frankia alni: FRAAL5231Help
Entry
FRAAL5231         CDS       T00384                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fal  Frankia alni
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fal00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5671531..5672076)
Genome map
AA seq 181 aa AA seqDB search
MGLTVLSGPSGVGKGTVVAAVRERHPEVWVSVSATTRAPRPGETDGVEYHFVDAEEFARM
VKAGEFVEHAMFAGHAYGTPRGPLRERLAAGVPCLLEIELLGARQVRSAMPDARFVFLAP
PTFEELVRRLTGRGTESPEVIARRLDRARIELAAETEFDHVVVNDDVRAAAARLVALMIG
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctcacagtgctgtccgggccgtccggcgtcgggaagggaacggtcgtcgcggcc
gtccgcgagcgtcatcccgaggtctgggtctcggtcagtgcgaccacccgggctccccgg
cccggggagaccgacggcgtcgagtatcacttcgtcgacgccgaggagttcgcccggatg
gtcaaggccggcgagttcgtcgagcacgcgatgttcgccgggcacgcctacggcaccccg
cggggtcccctgcgggaacggctcgccgccggcgtcccgtgcctgctggagatcgagctg
ctcggggcccgccaggtgcgttcggcgatgcccgacgcccggttcgtcttcctcgcgcca
ccgacgttcgaggagctggtccggcggctgaccggccgggggaccgagtcacccgaggtc
atcgcccgccggttggaccgggctcgcatcgagctggcggccgagacggagttcgaccac
gtggtcgtcaacgacgatgtgcgggccgcggccgcgcggttggtagcattgatgatcggc
tcctag

DBGET integrated database retrieval system