KEGG   Frankia alni: FRAAL5231Help
Entry
FRAAL5231         CDS       T00384                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fal  Frankia alni
Pathway
fal00230  Purine metabolism
fal01100  Metabolic pathways
Module
fal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FRAAL5231 (gmk)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FRAAL5231 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_29 AAA_33 RsgA_GTPase AAA_28 AAA_22 AAA_17
Motif
Other DBs
NCBI-ProteinID: CAJ63864
RhizoBase: FRAAL5231
UniProt: Q0RF84
Position
complement(5671531..5672076)
Genome map
AA seq 181 aa AA seqDB search
MGLTVLSGPSGVGKGTVVAAVRERHPEVWVSVSATTRAPRPGETDGVEYHFVDAEEFARM
VKAGEFVEHAMFAGHAYGTPRGPLRERLAAGVPCLLEIELLGARQVRSAMPDARFVFLAP
PTFEELVRRLTGRGTESPEVIARRLDRARIELAAETEFDHVVVNDDVRAAAARLVALMIG
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctcacagtgctgtccgggccgtccggcgtcgggaagggaacggtcgtcgcggcc
gtccgcgagcgtcatcccgaggtctgggtctcggtcagtgcgaccacccgggctccccgg
cccggggagaccgacggcgtcgagtatcacttcgtcgacgccgaggagttcgcccggatg
gtcaaggccggcgagttcgtcgagcacgcgatgttcgccgggcacgcctacggcaccccg
cggggtcccctgcgggaacggctcgccgccggcgtcccgtgcctgctggagatcgagctg
ctcggggcccgccaggtgcgttcggcgatgcccgacgcccggttcgtcttcctcgcgcca
ccgacgttcgaggagctggtccggcggctgaccggccgggggaccgagtcacccgaggtc
atcgcccgccggttggaccgggctcgcatcgagctggcggccgagacggagttcgaccac
gtggtcgtcaacgacgatgtgcgggccgcggccgcgcggttggtagcattgatgatcggc
tcctag

DBGET integrated database retrieval system