KEGG   Frankia alni: FRAAL5238Help
Entry
FRAAL5238         CDS       T00384                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fal  Frankia alni
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fal00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fal00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5681467..5682423)
Genome map
AA seq 318 aa AA seqDB search
MVGVGGERRSGMKGHLLSTEDLSRDDALLVLDTAERMARVAEASVRKLPTLRGRTVVNLF
FEDSTRTRTSFEVAAKRLSADVINFSARGSSVSKGESLKDTAQTLEAMGADAVVCRHSAS
GAPHRLATWVRGSVVNAGDGTHEHPTQALLDAFTMRQRLGRVDGLAVTIVGDVLHSRVAR
SNVWLLATLGASVTVVAPPTLLPIGVSSWPVEVSYDLDAVLPKTDVVMMLRVQRERMSAA
FFPTEREYSRRYGLDVDRAATLPEHALVMHPGPMVRGMEIASRVADSDRSTVVEQVANGV
SVRMAVLYLLLGGSGEVS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgtcggcggcgaacggaggtcgggtatgaagggccacctgctgtcgacggag
gacctcagccgggacgacgcgctgctggtgctggacaccgcggagcggatggcgcgggtc
gccgaggcgtcggtccgcaagctgccgaccctgcggggccgcaccgtggtcaaccttttc
ttcgaggattccacccgtacccgcacgtccttcgaagtagccgccaagagactgtcggcc
gatgtgatcaatttttcggctcgcgggtcaagcgtgtcgaagggcgagagcctgaaggac
accgcgcagaccctcgaggcgatgggcgccgacgcggtggtctgccggcattcggccagc
ggcgcgccgcaccggctggcgacctgggtgcgcggcagcgtcgtgaacgccggcgacggc
acccacgagcatccgacccaggcgctgctcgacgcgttcaccatgcgccagcggctcggt
cgggtcgacgggctcgccgtcaccatcgtcggtgacgtgctgcattcccgggtggcgcgg
tccaacgtctggctgctggccaccctgggagccagtgtgacggtggtggctccgccgacg
ctgttgcccatcggtgtctcctcgtggccggtcgaggtgtcgtacgacctcgacgcggtg
ctgcccaagaccgatgtggtgatgatgctgcgggtacagcgggagcggatgtcggcggcg
ttcttccccaccgagcgggagtacagccgccgctacgggctggacgtcgaccgggccgcg
accctgcccgagcacgccctggtcatgcatccggggccgatggtgcgcgggatggagatc
gcctcccgggtcgccgactccgaccggtcgacggtggtggagcaggttgcgaacggggtg
agcgtgcggatggccgtgttgtatctgctgctgggcggttccggggaggtctcatga

DBGET integrated database retrieval system