KEGG   Frankia alni: FRAAL5274Help
Entry
FRAAL5274         CDS       T00384                                 

Gene name
adhC1
Definition
(GenBank) Alcohol dehydrogenase (Zinc containing)
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00071  Fatty acid degradation
fal00350  Tyrosine metabolism
fal00625  Chloroalkane and chloroalkene degradation
fal00626  Naphthalene degradation
fal00680  Methane metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
fal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5274 (adhC1)
  Energy metabolism
   00680 Methane metabolism
    FRAAL5274 (adhC1)
  Lipid metabolism
   00071 Fatty acid degradation
    FRAAL5274 (adhC1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    FRAAL5274 (adhC1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FRAAL5274 (adhC1)
   00626 Naphthalene degradation
    FRAAL5274 (adhC1)
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FRAAL5274 (adhC1)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     FRAAL5274 (adhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 PALP NADH_4Fe-4S NAD_binding_7 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAJ63907
RhizoBase: FRAAL5274
UniProt: Q0RF44
Position
5716509..5717756
Genome map
AA seq 415 aa AA seqDB search
METLAAVLWDRSSPWSVEPIELDPPGPDEVLVELHASGLCHSEEHIVTGDMPFRLPCVGG
HEGAGVVLEVGSRVSSVVPGDHVVFGFVPSCGRCRQCATGHQNLCELGAKMYTGRQIADG
TARHHARGQDLAIACMIGTFAHHTVAHESSCVRIPQHVPLDRACLLGCGFVTGWGSAVYA
ADVRPGDTVAVAGVGGIGAAAIQGARLAGARVIVAVETVAEKQELILRLGATHVATSWDE
AAAVIRGATWNRGVDRFICTMSRGDGELLGRALAMTASRGRVVVTNVHPAGKRTVSLDMM
DLTLSEKHIVGTIYGSGNARADIPKIIELWQHGQVDLDAVVSHSYPLDGVNDGYEDMRSG
RFLRTVLRYPAADALDARRAAHTRVPPDAQVPPDAQVPPDARPASAPAQVERLPA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccctcgccgctgtgctgtgggaccgcagttcgccgtggtcggtcgagccgatc
gagctcgatccgcccggcccggacgaggtgctcgtcgagctgcacgcctccggtctgtgt
cactcggaggagcacatcgtcaccggtgacatgccgttccggctgccgtgcgtcggcggg
cacgagggcgccggggtcgtgctggaggtcggctcccgggtcagctcggtcgtccccggc
gaccatgtcgtcttcggcttcgtgccgtcctgcgggcggtgccggcagtgcgcgaccggc
caccagaacctctgtgagctcggcgcgaagatgtacacgggccgccagatcgccgacggc
accgcgcgccaccacgcccgcggccaggacctggcgatcgcctgcatgatcggcacgttc
gcccatcacaccgtggcccacgagtcgagctgcgtccggatcccgcagcacgtcccgctg
gaccgggcctgcctgctgggctgcggcttcgtcaccggctggggctcggcggtgtacgcc
gccgacgtgcggccgggcgacacggtcgcggtcgcgggagtcgggggcatcggcgcggcg
gcgatccagggcgcccggctggccggcgcccgcgtcatcgtcgccgtcgagacggtggcc
gagaagcaggagctcatccttcggctcggcgcgacccacgtcgccacctcgtgggacgag
gccgccgccgtcatccggggggcgacctggaaccgcggggtcgaccggttcatctgcacg
atgagccgcggcgacggcgaactgctcgggcgggcgctggcgatgaccgccagccgcggc
cgggtcgtggtgaccaacgtccatccggcggggaagcggacggtgtcgctggacatgatg
gatctgaccctgtccgagaagcacatcgtcggcacgatctacggttcgggcaacgcccgc
gccgacatcccgaagatcatcgagctgtggcagcacggccaggtcgacctcgacgcggtg
gtgagccacagctaccctctcgacggcgtcaacgacggctacgaggacatgcgcagcggc
cgcttcctgcgcaccgtgctgcgttacccggccgccgacgccctcgacgcccggcgcgcg
gcccacacccgggtgccgcccgacgcccaggtgccgcccgacgcccaggtgccgcccgac
gcgcgtccggcttcggcgcccgcgcaggtagagaggctgccggcatga

DBGET integrated database retrieval system