KEGG   Frankia alni: FRAAL5274Help
Entry
FRAAL5274         CDS       T00384                                 

Gene name
adhC1
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00121  
S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL5274 (adhC1)
   01220 Degradation of aromatic compounds
    FRAAL5274 (adhC1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5274 (adhC1)
  Energy metabolism
   00680 Methane metabolism
    FRAAL5274 (adhC1)
  Lipid metabolism
   00071 Fatty acid degradation
    FRAAL5274 (adhC1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    FRAAL5274 (adhC1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FRAAL5274 (adhC1)
   00626 Naphthalene degradation
    FRAAL5274 (adhC1)
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FRAAL5274 (adhC1)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     FRAAL5274 (adhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5716509..5717756
Genome map
AA seq 415 aa AA seqDB search
METLAAVLWDRSSPWSVEPIELDPPGPDEVLVELHASGLCHSEEHIVTGDMPFRLPCVGG
HEGAGVVLEVGSRVSSVVPGDHVVFGFVPSCGRCRQCATGHQNLCELGAKMYTGRQIADG
TARHHARGQDLAIACMIGTFAHHTVAHESSCVRIPQHVPLDRACLLGCGFVTGWGSAVYA
ADVRPGDTVAVAGVGGIGAAAIQGARLAGARVIVAVETVAEKQELILRLGATHVATSWDE
AAAVIRGATWNRGVDRFICTMSRGDGELLGRALAMTASRGRVVVTNVHPAGKRTVSLDMM
DLTLSEKHIVGTIYGSGNARADIPKIIELWQHGQVDLDAVVSHSYPLDGVNDGYEDMRSG
RFLRTVLRYPAADALDARRAAHTRVPPDAQVPPDAQVPPDARPASAPAQVERLPA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccctcgccgctgtgctgtgggaccgcagttcgccgtggtcggtcgagccgatc
gagctcgatccgcccggcccggacgaggtgctcgtcgagctgcacgcctccggtctgtgt
cactcggaggagcacatcgtcaccggtgacatgccgttccggctgccgtgcgtcggcggg
cacgagggcgccggggtcgtgctggaggtcggctcccgggtcagctcggtcgtccccggc
gaccatgtcgtcttcggcttcgtgccgtcctgcgggcggtgccggcagtgcgcgaccggc
caccagaacctctgtgagctcggcgcgaagatgtacacgggccgccagatcgccgacggc
accgcgcgccaccacgcccgcggccaggacctggcgatcgcctgcatgatcggcacgttc
gcccatcacaccgtggcccacgagtcgagctgcgtccggatcccgcagcacgtcccgctg
gaccgggcctgcctgctgggctgcggcttcgtcaccggctggggctcggcggtgtacgcc
gccgacgtgcggccgggcgacacggtcgcggtcgcgggagtcgggggcatcggcgcggcg
gcgatccagggcgcccggctggccggcgcccgcgtcatcgtcgccgtcgagacggtggcc
gagaagcaggagctcatccttcggctcggcgcgacccacgtcgccacctcgtgggacgag
gccgccgccgtcatccggggggcgacctggaaccgcggggtcgaccggttcatctgcacg
atgagccgcggcgacggcgaactgctcgggcgggcgctggcgatgaccgccagccgcggc
cgggtcgtggtgaccaacgtccatccggcggggaagcggacggtgtcgctggacatgatg
gatctgaccctgtccgagaagcacatcgtcggcacgatctacggttcgggcaacgcccgc
gccgacatcccgaagatcatcgagctgtggcagcacggccaggtcgacctcgacgcggtg
gtgagccacagctaccctctcgacggcgtcaacgacggctacgaggacatgcgcagcggc
cgcttcctgcgcaccgtgctgcgttacccggccgccgacgccctcgacgcccggcgcgcg
gcccacacccgggtgccgcccgacgcccaggtgccgcccgacgcccaggtgccgcccgac
gcgcgtccggcttcggcgcccgcgcaggtagagaggctgccggcatga

DBGET integrated database retrieval system