KEGG   Frankia alni: FRAAL5478Help
Entry
FRAAL5478         CDS       T00384                                 

Definition
(GenBank) Putative IclR-family transcriptional regulator
  KO
K13641  IclR family transcriptional regulator, acetate operon repressor
Organism
fal  Frankia alni
Brite
Transcription factors [BR:fal03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    FRAAL5478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 HTH_24 MarR DUF2612 HTH_6
Motif
Other DBs
NCBI-ProteinID: CAJ64111
RhizoBase: FRAAL5478
UniProt: Q0REJ7
Position
complement(5924066..5924758)
Genome map
AA seq 230 aa AA seqDB search
MVEAAGGGCSISAMATATGLPLPTIHRLVQTLTTRGYLRRLPDRRYCLGSRLVPLGAGAN
ALLGERAAPVLRALADGLGESANLAVLAGERAEYVAQAPGVYSMRTFTEVGRRVPLHCTG
VGKALLSTLGDDEARAILARSTLSTHTATTIVEVDALLDELAGIRARGYALDEGEMEVGV
RCVAMPVSVPGMAPMALSVSGPAARMSDDLAGRAAPALVHACAALATALT
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaggcggcgggcggcggctgttcgatcagcgcgatggccacggcgaccggcctg
ccgctgccgaccatccaccggctggtgcagaccctcaccacccgcggctacctgcgccgc
ctgcccgaccgccggtactgcctgggttcccggctggtcccgttgggcgccggcgcgaac
gcgctgctcggcgagcgggccgccccggtcctgcgcgcgctcgccgacgggctcggcgag
tcggccaacctcgcggtcctggccggcgagcgggccgagtacgtcgcccaggcccccggg
gtgtactcgatgcgcaccttcaccgaggtgggccggcgggtccccctgcactgcaccggc
gtcggcaaggcgctgctgtcgaccctcggtgacgacgaggcccgcgccatcctggcgcgt
tcgacgctgtccacccacaccgccacgaccatcgtcgaggtcgacgcgctgctcgacgag
ctggccggcatccgcgcccgcggctacgcgctcgacgagggagagatggaggtcggggtg
cgctgcgtcgcgatgccggtgtccgtgcccggcatggcgccgatggcgctgtccgtgtca
ggccccgcggcgcgcatgagcgacgacctcgccggccgggccgcgccggccctcgtccac
gcctgcgccgccctcgccaccgccctcacctga

DBGET integrated database retrieval system