KEGG   Frankia alni: FRAAL5481Help
Entry
FRAAL5481         CDS       T00384                                 

Gene name
aceB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
fal  Frankia alni
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL5481 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FRAAL5481 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    FRAAL5481 (aceB)
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FRAAL5481 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5926603..5928780
Genome map
AA seq 725 aa AA seqDB search
MTERIQIGALQVAASLHEFVQTAALPGSGVEPAAFWRGVEEIFTALTPVNRALLAERDEL
QRKIDDWHRARAGSGHDAQAYHDFLVEIGYLRPEPEPFEIATENVDDEIALTAGPQLVVP
VLNARYALNAANARWGSLYDALYGTDAIAEDDGAHRDGPYNPVRGAKVIAQARALLDEVA
PLREGGHADAAQYAVVDGELVVTLTTGTTTGLADPSALRGYTGAAASPSGILLVHHGLHV
EILIDRAGAIGAGDPAGVQDVVLEAALTTIVDFEDSIAAVDAEDKVAAYANWLALNQGTL
TATVTKGGSSFDRALAADRTFTAPDGGQILLPGRALLLVRNVGHLMTTDAILDADGAEVF
EGILDAIITSLAALPSLRADAARRNSRTGSIYIVKPKMHGPAEAALTVDLFTRVEKLLGL
PADTLKIGIMDEERRTTVNLAASIEAARRRVVFINTGFLDRSGDEIHTSFEAGPMVRKAD
MKTQTWITTYENNNVDQGLAAGMSGRAQIGKGMWAMPDLMADMLTQKIGQLRAGATTAWV
PSPTAATLHALHYHQVDVFARQRELAERPRADLADILRIPLGDPSAWSAEDRQQEIDNNA
QSILGYVVRWIDQGIGCSKVPDIHDVALMEDRATLRISSQLMANWLRHGVVTPEQVHASL
QRMAAVVDKQNADDPAYRPMAPDFDGVAFRCATSLVFDGARQPNGYTEPILHAHRREAKA
LAASL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacggatccagatcggcgctctccaggtggcggcgagcctgcacgagttcgtg
cagaccgccgccctgcccggctcgggcgtcgagcccgcggccttctggcggggcgtcgag
gagatcttcaccgcgctcacgcccgtcaaccgggccctgctcgccgagcgcgacgagctg
cagaggaagatcgacgactggcaccgcgcccgcgccggcagcgggcacgacgcgcaggcc
tatcacgacttcctcgtcgagatcggctatctgcggcccgagcccgagccgttcgagatc
gcgaccgagaacgtcgacgacgagatcgcgctgaccgccggtccgcagctcgtcgtgccg
gtcctcaacgcccggtacgcgctcaacgccgcgaacgcccgctggggctcgctgtacgac
gcgctctacggcaccgacgcgatcgccgaggacgacggtgcgcaccgcgacgggccctac
aatccggtccgcggcgcgaaggtcatcgcccaggcgcgggcgctgctcgacgaggtcgcg
ccgctgcgcgagggcggccacgccgacgcggcgcagtacgccgtcgtcgacggcgagctg
gtcgtcacgctgaccaccggtacgacgaccggcctcgccgacccctcggcgctgcgcggc
tacaccggcgcggcggcgtcccccagcggaatcctgctggtccaccacggcctgcatgtc
gagatcctcatcgaccgcgccggtgcgatcggcgccggcgaccccgccggggtgcaggac
gtcgtcctcgaggccgcgctcaccacgatcgtcgacttcgaggactccatcgccgccgtc
gatgccgaggacaaggtggcggcctacgcgaactggctggcgctgaaccagggcaccctg
accgcgacggtgaccaagggcgggtcgtcgttcgaccgcgcgctggccgcggaccggacg
ttcaccgcgccggacggcgggcagatcctgctcccgggccgggcgctgctgctggtccgc
aacgtcgggcacctgatgaccaccgacgcgatcctcgacgccgacggcgcggaggtgttc
gagggcatcctcgacgcgatcatcacgtccctggcggcgctgccgagcctgcgcgcggac
gcggcccggcgcaacagccgcaccggttcgatctacatcgtcaagccgaagatgcacggc
ccggccgaggccgccctcaccgtcgacctgttcacccgggtcgagaagctgctcggcctg
cccgccgacaccctcaagatcgggatcatggacgaggaacgccgcaccacggtgaacctc
gccgcgtcgatcgaggcggcgcggcggcgggtggtgttcatcaacaccggcttcctggac
cggtccggcgacgagatccacacctccttcgaggccgggccgatggtgcgcaaggccgac
atgaagacgcagacctggatcaccacctacgagaacaacaacgtcgaccaggggctggcg
gccggcatgtcggggcgcgcacagatcggcaagggcatgtgggcgatgcccgacctgatg
gcagacatgctgacccagaagatcggccagctccgggccggcgcgacgacggcctgggtg
ccctcccccaccgcggcgaccctgcacgcgctgcactaccaccaggtcgacgtcttcgcc
cgccagcgcgagctggccgaacggccccgcgcggacctggccgacatcctgcggatcccg
ctgggtgacccgagcgcgtggagcgccgaggaccgccagcaggagatcgacaacaacgcg
cagtcgatcctgggttacgtcgtgcgctggatcgaccagggcatcggctgctcgaaggtg
cccgacatccacgacgtcgcgctgatggaggaccgcgcgaccctgcggatctccagccag
ctcatggccaactggctgcgccacggcgtcgtcaccccggagcaggtgcacgccagcctc
cagcggatggccgccgtcgtcgacaagcagaacgccgacgacccggcctaccggccgatg
gccccggacttcgacggtgtcgccttccgctgcgccaccagcctcgtcttcgacggcgcc
cggcagcccaacggctacaccgagccgatcctgcacgcccatcgccgggaggcgaaggcg
ctggccgcgagcctgtga

DBGET integrated database retrieval system