KEGG   Frankia alni: FRAAL5481Help
Entry
FRAAL5481         CDS       T00384                                 

Gene name
aceB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fal  Frankia alni
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL5481 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FRAAL5481 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    FRAAL5481 (aceB)
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FRAAL5481 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5926603..5928780
Genome map
AA seq 725 aa AA seqDB search
MTERIQIGALQVAASLHEFVQTAALPGSGVEPAAFWRGVEEIFTALTPVNRALLAERDEL
QRKIDDWHRARAGSGHDAQAYHDFLVEIGYLRPEPEPFEIATENVDDEIALTAGPQLVVP
VLNARYALNAANARWGSLYDALYGTDAIAEDDGAHRDGPYNPVRGAKVIAQARALLDEVA
PLREGGHADAAQYAVVDGELVVTLTTGTTTGLADPSALRGYTGAAASPSGILLVHHGLHV
EILIDRAGAIGAGDPAGVQDVVLEAALTTIVDFEDSIAAVDAEDKVAAYANWLALNQGTL
TATVTKGGSSFDRALAADRTFTAPDGGQILLPGRALLLVRNVGHLMTTDAILDADGAEVF
EGILDAIITSLAALPSLRADAARRNSRTGSIYIVKPKMHGPAEAALTVDLFTRVEKLLGL
PADTLKIGIMDEERRTTVNLAASIEAARRRVVFINTGFLDRSGDEIHTSFEAGPMVRKAD
MKTQTWITTYENNNVDQGLAAGMSGRAQIGKGMWAMPDLMADMLTQKIGQLRAGATTAWV
PSPTAATLHALHYHQVDVFARQRELAERPRADLADILRIPLGDPSAWSAEDRQQEIDNNA
QSILGYVVRWIDQGIGCSKVPDIHDVALMEDRATLRISSQLMANWLRHGVVTPEQVHASL
QRMAAVVDKQNADDPAYRPMAPDFDGVAFRCATSLVFDGARQPNGYTEPILHAHRREAKA
LAASL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacggatccagatcggcgctctccaggtggcggcgagcctgcacgagttcgtg
cagaccgccgccctgcccggctcgggcgtcgagcccgcggccttctggcggggcgtcgag
gagatcttcaccgcgctcacgcccgtcaaccgggccctgctcgccgagcgcgacgagctg
cagaggaagatcgacgactggcaccgcgcccgcgccggcagcgggcacgacgcgcaggcc
tatcacgacttcctcgtcgagatcggctatctgcggcccgagcccgagccgttcgagatc
gcgaccgagaacgtcgacgacgagatcgcgctgaccgccggtccgcagctcgtcgtgccg
gtcctcaacgcccggtacgcgctcaacgccgcgaacgcccgctggggctcgctgtacgac
gcgctctacggcaccgacgcgatcgccgaggacgacggtgcgcaccgcgacgggccctac
aatccggtccgcggcgcgaaggtcatcgcccaggcgcgggcgctgctcgacgaggtcgcg
ccgctgcgcgagggcggccacgccgacgcggcgcagtacgccgtcgtcgacggcgagctg
gtcgtcacgctgaccaccggtacgacgaccggcctcgccgacccctcggcgctgcgcggc
tacaccggcgcggcggcgtcccccagcggaatcctgctggtccaccacggcctgcatgtc
gagatcctcatcgaccgcgccggtgcgatcggcgccggcgaccccgccggggtgcaggac
gtcgtcctcgaggccgcgctcaccacgatcgtcgacttcgaggactccatcgccgccgtc
gatgccgaggacaaggtggcggcctacgcgaactggctggcgctgaaccagggcaccctg
accgcgacggtgaccaagggcgggtcgtcgttcgaccgcgcgctggccgcggaccggacg
ttcaccgcgccggacggcgggcagatcctgctcccgggccgggcgctgctgctggtccgc
aacgtcgggcacctgatgaccaccgacgcgatcctcgacgccgacggcgcggaggtgttc
gagggcatcctcgacgcgatcatcacgtccctggcggcgctgccgagcctgcgcgcggac
gcggcccggcgcaacagccgcaccggttcgatctacatcgtcaagccgaagatgcacggc
ccggccgaggccgccctcaccgtcgacctgttcacccgggtcgagaagctgctcggcctg
cccgccgacaccctcaagatcgggatcatggacgaggaacgccgcaccacggtgaacctc
gccgcgtcgatcgaggcggcgcggcggcgggtggtgttcatcaacaccggcttcctggac
cggtccggcgacgagatccacacctccttcgaggccgggccgatggtgcgcaaggccgac
atgaagacgcagacctggatcaccacctacgagaacaacaacgtcgaccaggggctggcg
gccggcatgtcggggcgcgcacagatcggcaagggcatgtgggcgatgcccgacctgatg
gcagacatgctgacccagaagatcggccagctccgggccggcgcgacgacggcctgggtg
ccctcccccaccgcggcgaccctgcacgcgctgcactaccaccaggtcgacgtcttcgcc
cgccagcgcgagctggccgaacggccccgcgcggacctggccgacatcctgcggatcccg
ctgggtgacccgagcgcgtggagcgccgaggaccgccagcaggagatcgacaacaacgcg
cagtcgatcctgggttacgtcgtgcgctggatcgaccagggcatcggctgctcgaaggtg
cccgacatccacgacgtcgcgctgatggaggaccgcgcgaccctgcggatctccagccag
ctcatggccaactggctgcgccacggcgtcgtcaccccggagcaggtgcacgccagcctc
cagcggatggccgccgtcgtcgacaagcagaacgccgacgacccggcctaccggccgatg
gccccggacttcgacggtgtcgccttccgctgcgccaccagcctcgtcttcgacggcgcc
cggcagcccaacggctacaccgagccgatcctgcacgcccatcgccgggaggcgaaggcg
ctggccgcgagcctgtga

DBGET integrated database retrieval system