KEGG   Frankia alni: FRAAL5644Help
Entry
FRAAL5644         CDS       T00384                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6099660..6100451
Genome map
AA seq 263 aa AA seqDB search
MTIRTASQEVPMSPTDPIPLYGPQYKRDPYPLYRRLRATGPVHRVRFPSGVIGWLVTGYR
AAHEALNDHRLGKNHALGTSDALSALIDEEGLRHLDLFSLRDILGDLPYDDKRSSVSRRY
GPTSEQLRAEVRSDEDTRRLYQGITRFLVEDTAEFVGSRSALQRECRQRAYGVIGRSRAW
GRLVAEHHPRAVRLSIHPQRRGTSKFGIRLLESSDAWMTPWHATVLRRADGASELMRRAD
AQRLGRLVTRDGRPSHFQAHAAV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccggaccgcatcccaggaggtccccatgtcaccgaccgatccgatccccctg
tacgggccccagtacaagcgcgatccctaccccctctatcggcgactgcgcgccaccgga
cccgttcatcgggtccgctttcccagcggcgtgatcggctggctggtcaccggctaccgg
gcagcccacgaagcgctgaacgaccaccggctcggcaagaatcacgcactgggtacctcc
gatgcgctgagcgccctgatcgacgaggagggactccgtcacctcgacctgttcagcctg
cgcgacatcctcggggaccttccctacgacgacaagcggtcgtcggtcagcaggcgttat
ggaccgacctccgagcagctgcgggccgaggtgcgatccgatgaggacacccgccgcctg
taccagggcataacccgatttctggtcgaggacaccgccgagtttgtgggcagccggtcg
gcactgcagcgtgagtgccgccagcgggcctatggcgtcatcggccgcagtcgagcctgg
gggcggctggtcgccgagcaccatccgcgggcggtgcgtctgtcgatccatccccagcgc
cgcggcacgtccaagttcggcatccgcctgttggaaagctccgacgcctggatgacaccg
tggcacgccacagttctgcgccgggcggacggcgcctcggaactgatgcgacgcgcggac
gcgcagcggctcggccggttggtgacgcgcgacggccggccgagccatttccaggcccac
gctgcggtctga

DBGET integrated database retrieval system