KEGG   Frankia alni: FRAAL5682Help
Entry
FRAAL5682         CDS       T00384                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase (Polyphosphate-glucose phosphotransferase)
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00520  Amino sugar and nucleotide sugar metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
Module
fal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5682 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL5682 (ppgK)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     FRAAL5682 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CAJ64315
RhizoBase: FRAAL5682
UniProt: Q0RE01
Position
6143454..6144323
Genome map
AA seq 289 aa AA seqDB search
MQVFGVDVGGSGIKGAPVNVEDGTLAAPRFRIPTPQPAEPAAVAATIAEVVGHFDWSGPV
GVALPSVVKNGVALTAANIAPSWIGTDIVGVLAGALGRADADATSVPAQPGGSATAADIT
TVNDADAAGIAEMAFGAGRDTAGLVVMTTFGTGIGTALFLHGQLVPNTELGHLEIHGHDA
ETKASDAAREREDLSWEKWAKRVTRYLNTLEALLWPDLIIIGGGVSKKADRFLDQLELRT
RVVPAQLQNEAGIVGAALSGLADQSRPRPSARPARRRGPATRPPGGRRP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcttcggagttgacgtcggagggagcgggatcaagggcgctccggtcaacgtc
gaggacggcacgctggccgcgccccggtttcggatcccgaccccgcagcccgccgagccc
gccgccgtcgcggcgaccatcgccgaggtcgtcggccacttcgactggtccggtccggtg
ggtgtcgccctgccgtcggtggtcaagaacggcgtggcgctgacggcggcgaacatcgcg
ccgtcctggatcggcaccgacatcgtcggcgtgctcgccggcgccctcggccgcgccgac
gccgacgccacctcggtgccggcgcagccgggcggatccgccactgcggcggacatcacc
acggtgaacgacgcggacgcggccgggatcgcggagatggccttcggggcgggccgcgac
accgccgggctggtcgtcatgacgacgttcggcaccggcatcggaaccgccctgttcctg
cacgggcagctcgttccgaacaccgagctcgggcacctggagatccacggacacgacgcg
gagacgaaggcctccgacgcggcccgcgagcgggaggacctgtcgtgggagaagtgggcc
aagcgggtgacccggtacctcaacacgctcgaggcactgctctggcccgatctgatcatc
atcggcggcggggtcagcaagaaggccgacaggtttctcgaccagctcgagctgcgcacc
cgggtggtgccggcgcagctccagaacgaggcgggcatcgtcggtgccgcgctgtccggc
ctggccgatcagagccgcccgcgaccctcggcccgcccggcgcggcggcggggaccggcg
acccggccgcccggcggccggcgaccgtag

DBGET integrated database retrieval system