KEGG   Frankia alni: FRAAL5785Help
Entry
FRAAL5785         CDS       T00384                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K07460  
putative endonuclease
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(6271503..6271865)
Genome map
AA seq 120 aa AA seqDB search
MAMRAKDALGRFGEEVASRHLAAGGAAILDRNWRCREGELDLVLRDGADLVFCEVKTRSG
TRFGSAAEAVVGRKAARIRRLAARWLAEHPHAPSSVRFDVVLVSRPPVGPVRVEHLRGAF
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatgcgcgcgaaggacgcactgggtcggttcggagaggaggtcgcgtcccggcat
ctggcggcagggggcgcggcgatcctcgaccgtaactggcgctgccgggaaggcgagctc
gatctcgtgctccgggacggcgcagatctggtgttctgcgaggtcaagacccgatccggg
acgcgctttgggtccgccgcggaagcggtggtcggtcggaaggcggctcggatccgccgg
ttggccgcccgctggctcgcggagcacccgcacgcgccctcttccgtgcgtttcgacgtg
gtgttggtgtcgcggccgccggtcggcccggtgcgcgtcgagcatcttcggggtgcgttc
tga

DBGET integrated database retrieval system