KEGG   Frankia alni: FRAAL5802Help
Entry
FRAAL5802         CDS       T00384                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fal  Frankia alni
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fal03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6287241..6288206)
Genome map
AA seq 321 aa AA seqDB search
MPELPEVEVVRRGLQRGVVGRVIASVAVCHPRAVRRHPAGAGDFAALLVGQRVTAARRRG
KYLWLALRTDLAAAVAAAAPALAIEPGTEGAPAGLPVLESPPSAAPDDALIAHLGMSGQL
LVVPPTTPDQRHLRIRFTFVDGGRELRFVDQRTFGGLAVAVGGGELPEPVAHIARDPLDP
AFDEDLVVRRLRDRRTGVKRALLDQTLVSGVGNIYADEALWAARMHYAHPTETLTRPEVR
RLLDCVRTVMIAALDAGGTSFDRLYVSTDGVSGLFERSLAVYGRAGQPCGRCGDTIRRDA
FMNRSSFTCPTCQRPPRRPRW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctaccagaggtggaggtcgtgcgccgcgggctgcagcgcggtgtcgttggc
cgggtgatcgcctcggttgcggtgtgtcatccgcgtgccgtgcgccgtcatccggccggc
gccggcgacttcgccgctctgctcgtcgggcagcgggtgacggccgcgagacgtcgcggc
aagtacctctggctagcgctgaggacggacctcgcggccgcggttgcggccgcggcgccg
gcgctggcgatcgaaccggggacagagggtgcgccggcgggtctgcccgtgctggagtcg
cccccgtctgccgcacccgacgatgccctgatcgcgcatctcggtatgagtggtcaacta
ctcgtggtgccgccgacgactccggaccagagacacctgcgcattcgcttcaccttcgtc
gacggaggccgggaactgcggttcgtcgaccagcgcaccttcggcggcttggcggtcgcc
gtcggcggcggggagctgcccgagccggtcgcccacatcgcccgggacccgcttgatccc
gccttcgacgaggacctcgtcgtccggcgactgcgtgaccgccgtaccggcgtcaagcgg
gcgctgctcgatcagacgctggtcagcggtgtgggcaacatctatgcggacgaggcgctg
tgggcggccaggatgcactacgcccatccgaccgagacgttgacccgtcccgaggtccgc
cggctgctggattgtgtccgcacggtcatgattgcggccctcgacgcgggtgggacgtcc
ttcgacaggctgtatgtctcgaccgacggggtcagtggactgtttgagcggtcactggcg
gtctatggtcgcgcagggcagccctgcggccggtgtggggacacgatccgccgcgacgca
ttcatgaacagatccagcttcacctgccccacctgccagcgcccaccccgccgacccaga
tggtag

DBGET integrated database retrieval system