KEGG   Frankia alni: FRAAL5876Help
Entry
FRAAL5876         CDS       T00384                                 

Definition
phosphotransferase, sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL5876
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5876
   00052 Galactose metabolism
    FRAAL5876
   00500 Starch and sucrose metabolism
    FRAAL5876
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL5876
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FRAAL5876
   00524 Butirosin and neomycin biosynthesis
    FRAAL5876
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FRAAL5876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6365495..6366616)
Genome map
AA seq 373 aa AA seqDB search
MAGSSRPRGVVGVEASAPLVELGAGPALAVDVGGTKIAAAVVDADGTIRATARRPVPAHR
PSGPEPSESEPPESEPPESEPAGAEPAGAGPGRGRAAEEVFGALRECVNAALASAGVAAD
AVAGVGCGCAGPMQWPAGEVSPLNIPAWRGFPLRARLRELFPERPVLVHNDGVALVAGEH
WAGAGRGVRNLLAVTVSTGVGGGLVLGDRLFHGTSGNAGHIGHVVVDVDGPDCPCGGRGC
VEALASGPRTVHRARAAGWAPPAGQPADGHTLAAAAAAGDEIARRELARAGTAVGAGLAA
SASLLDLEAAVVAGGFAQSGPIFWDALLAGFERHAGLAFVRRMRIGRSDDPAGVALRGAA
AFVLAPERYGWPD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcgtcgcggccacggggggtcgtcggggtcgaggcgtcggcaccgctggtc
gagctcggagccgggcccgcgctggccgtggacgtcggcggcaccaagatcgcagcggcg
gtcgtcgacgccgacggcacgatccgtgccaccgcccgccgtcccgtgcctgctcaccgt
ccgtccgggcctgagccgtcggaatccgagccgcccgaatccgagccgcccgaatccgag
ccggccggagccgagccggccggagccgggccgggtcggggcagggcggccgaggaggtc
ttcggcgcgttgcgggagtgcgtcaacgcggcgctggcatccgccggggtcgcggcggac
gcggtagccggggtcggctgcgggtgcgcgggcccgatgcaatggccggcgggcgaggtg
tcgccgctgaacatcccggcctggcgggggttcccgctgcgcgcgcggctgcgcgagctg
ttccccgagcggcccgtgctggtccacaacgacggcgtcgcgctcgtcgccggcgagcac
tgggccggggcggggcggggcgtgcgcaacctgctcgcggtgaccgtctcgaccggcgtc
ggcggcgggctggtgctgggggaccggctgttccacggcacctccggcaacgccggccac
atcggtcacgtcgtcgtggacgtggacggaccggactgcccgtgcggcggtcggggctgc
gtcgaggcgctcgcgtccggtccgcggacggtgcaccgggcccgggcggccgggtgggct
ccccccgccggtcagccggccgacggtcacaccctcgccgccgcggccgcggccggtgac
gagatcgcccgccgcgagctcgcccgagccgggaccgccgtcggcgcggggctcgccgcc
agcgcgagcctgctcgacctggaggcggccgtcgtggccggcggcttcgcgcagtccggg
ccgatcttctgggacgccctgctcgccggcttcgagcgccatgccggtctggccttcgtc
cggcggatgcgcatcgggcgcagcgacgatccggccggcgtcgcgctgcggggagccgcc
gccttcgtcctggcgccggaacgctacggctggccagactga

DBGET integrated database retrieval system