KEGG   Frankia alni: FRAAL5876Help
Entry
FRAAL5876         CDS       T00384                                 

Definition
(GenBank) Putative phosphotransferase, sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00052  Galactose metabolism
fal00500  Starch and sucrose metabolism
fal00520  Amino sugar and nucleotide sugar metabolism
fal00521  Streptomycin biosynthesis
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
Module
fal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL5876
   00052 Galactose metabolism
    FRAAL5876
   00500 Starch and sucrose metabolism
    FRAAL5876
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL5876
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FRAAL5876
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FRAAL5876
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FRAAL5876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: CAJ64501
RhizoBase: FRAAL5876
UniProt: Q0RDG8
Position
complement(6365495..6366616)
Genome map
AA seq 373 aa AA seqDB search
MAGSSRPRGVVGVEASAPLVELGAGPALAVDVGGTKIAAAVVDADGTIRATARRPVPAHR
PSGPEPSESEPPESEPPESEPAGAEPAGAGPGRGRAAEEVFGALRECVNAALASAGVAAD
AVAGVGCGCAGPMQWPAGEVSPLNIPAWRGFPLRARLRELFPERPVLVHNDGVALVAGEH
WAGAGRGVRNLLAVTVSTGVGGGLVLGDRLFHGTSGNAGHIGHVVVDVDGPDCPCGGRGC
VEALASGPRTVHRARAAGWAPPAGQPADGHTLAAAAAAGDEIARRELARAGTAVGAGLAA
SASLLDLEAAVVAGGFAQSGPIFWDALLAGFERHAGLAFVRRMRIGRSDDPAGVALRGAA
AFVLAPERYGWPD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcgtcgcggccacggggggtcgtcggggtcgaggcgtcggcaccgctggtc
gagctcggagccgggcccgcgctggccgtggacgtcggcggcaccaagatcgcagcggcg
gtcgtcgacgccgacggcacgatccgtgccaccgcccgccgtcccgtgcctgctcaccgt
ccgtccgggcctgagccgtcggaatccgagccgcccgaatccgagccgcccgaatccgag
ccggccggagccgagccggccggagccgggccgggtcggggcagggcggccgaggaggtc
ttcggcgcgttgcgggagtgcgtcaacgcggcgctggcatccgccggggtcgcggcggac
gcggtagccggggtcggctgcgggtgcgcgggcccgatgcaatggccggcgggcgaggtg
tcgccgctgaacatcccggcctggcgggggttcccgctgcgcgcgcggctgcgcgagctg
ttccccgagcggcccgtgctggtccacaacgacggcgtcgcgctcgtcgccggcgagcac
tgggccggggcggggcggggcgtgcgcaacctgctcgcggtgaccgtctcgaccggcgtc
ggcggcgggctggtgctgggggaccggctgttccacggcacctccggcaacgccggccac
atcggtcacgtcgtcgtggacgtggacggaccggactgcccgtgcggcggtcggggctgc
gtcgaggcgctcgcgtccggtccgcggacggtgcaccgggcccgggcggccgggtgggct
ccccccgccggtcagccggccgacggtcacaccctcgccgccgcggccgcggccggtgac
gagatcgcccgccgcgagctcgcccgagccgggaccgccgtcggcgcggggctcgccgcc
agcgcgagcctgctcgacctggaggcggccgtcgtggccggcggcttcgcgcagtccggg
ccgatcttctgggacgccctgctcgccggcttcgagcgccatgccggtctggccttcgtc
cggcggatgcgcatcgggcgcagcgacgatccggccggcgtcgcgctgcggggagccgcc
gccttcgtcctggcgccggaacgctacggctggccagactga

DBGET integrated database retrieval system