KEGG   Frankia alni: FRAAL5950Help
Entry
FRAAL5950         CDS       T00384                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fal  Frankia alni
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FRAAL5950 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL5950 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FRAAL5950 (thrC)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FRAAL5950 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6450293..6451510)
Genome map
AA seq 405 aa AA seqDB search
MTTTSTARAESSAVGASAAAGSSTAAESSARAQSGSFPGGPAAPAASTQPDRSHRPWRGI
IEEYRDRLPVDDDTPVITLREGGTPLLLAEHLSELTGCEVHLKVEGANPTGSFKDRGMTM
AISRAVGAGSQAVICASTGNTSASAAAYAARAGITCAVLVPSGKIALGKLAQALVHGARL
LQLDGSFDDCLRVARELADTSPVTLVNSVNPYRLEGQKTASFEIVEALGRAPDVHCLPVG
NAGNITAYWRGYLEEDARLDAGRPRMCGFQAAGAAPIVRGEIVTSPQTIATAIRIGNPAS
WDFAVDARDSSGGLIDAVNDRQILAAYRLLARREGVFVEPSSAASVAGLLMARADGRIEA
GQRVVCTVTGNGLKDPDWAISGAARPETIRPTVAGAAEALGLQTS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacgtccacagctcgtgcggagtccagcgccgtcggagccagcgccgctgcc
gggtccagcactgctgccgagtccagcgctcgtgcgcagtccgggtcgttcccgggtggg
ccggcggcgccggcggcatccacccagcccgaccggtcgcaccggccgtggcgggggatc
atcgaggagtaccgcgaccggctgccggtcgacgacgacacgccggtgatcaccctgcgg
gagggcggcacgccgctgctgctcgccgagcacctgtccgagctcaccgggtgtgaggtt
catctcaaggtcgagggcgcgaacccgacgggttcgttcaaggaccgcgggatgacgatg
gccatcagccgggccgtcggcgcgggttcccaggcggtcatctgcgcctccacgggcaac
acctcggcctcggcggccgcctacgccgcccgtgccggcatcacctgcgcggtgctcgtc
cccagcgggaagatcgcgctgggcaagctcgcccaggcgctcgtgcacggcgcccggctg
ctccagctcgacggctcgttcgacgactgcctgcgggtcgcccgcgaactcgccgacacc
tcgccggtcaccctggtcaactcggtgaacccgtaccgcctggaaggccagaagacggcg
tcgttcgagatcgtcgaggcgctcgggcgggccccggacgtgcactgcctgccggtcggc
aacgccggcaacatcaccgcctactggcgggggtacctggaggaggacgcccgcctcgac
gccggccggccgcggatgtgcggtttccaggcggcgggcgcggccccgatcgtgcgcggc
gagatcgtcacctccccgcagacgatcgccacggcgatccgcatcggcaaccccgcctcc
tgggacttcgccgtcgacgcgcgggactcctccggcggcctcatcgacgccgtcaacgac
cggcagatcctcgccgcctaccggctgctcgcccgccgggagggcgtcttcgtcgagccg
tccagcgcggcgagcgtcgccgggctgctgatggcgcgggcggacggtcgcatcgaggcc
ggccagcgcgtcgtctgcaccgtgaccggcaacgggttgaaggatcccgactgggcgatc
agcggggcggcccggccggagacgatccggccgaccgtcgcgggcgccgccgaggcgctc
gggctgcagacttcgtga

DBGET integrated database retrieval system